[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : recU
DDBJ      :recU         recombination protein U
Swiss-Prot:RECU_STRZJ   RecName: Full=Holliday junction resolvase recU;         EC=3.1.22.-;AltName: Full=Recombination protein U homolog;

Homologs  Archaea  0/68 : Bacteria  150/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.52.1
:198 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   29->188 1y1oA PDBj 2e-51 59.1 %
:RPS:PDB   21->132 2e6nA PDBj 6e-16 14.9 %
:RPS:SCOP  29->190 1rznA  c.52.1.28 * 9e-45 51.0 %
:HMM:SCOP  28->193 1y1oA_ c.52.1.28 * 1.2e-60 54.2 %
:RPS:PFM   26->188 PF03838 * RecU 7e-50 62.7 %
:HMM:PFM   25->190 PF03838 * RecU 5.9e-73 60.5 162/165  
:BLT:SWISS 1->198 RECU_STRZJ e-116 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56166.1 GT:GENE recU GT:PRODUCT recombination protein U GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(329961..330557) GB:FROM 329961 GB:TO 330557 GB:DIRECTION - GB:GENE recU GB:PRODUCT recombination protein U GB:NOTE identified by match to protein family HMM PF03838; match to protein family HMM TIGR00648 GB:PROTEIN_ID ACF56166.1 GB:DB_XREF GI:194357718 GB:GENE:GENE recU LENGTH 198 SQ:AASEQ MVNYPHKVSSQKRQTSLSQPKNFANRGMSFEKMINATNDYYLSQGLAVIHKKPTPIQIVQVDYPQRSRAKIVEAYFRQASTTDYSGVYNGYYIDFEVKETKQKRAIPMKNFHPHQIQHMEQVLAQQGICFVLLHFSSQQETYLLPAFDLIRFYHQDKGQKSMPLEYIREYGYEIKAGAFPQIPYLNVIKEHLLGGKTR GT:EXON 1|1-198:0| SW:ID RECU_STRZJ SW:DE RecName: Full=Holliday junction resolvase recU; EC=3.1.22.-;AltName: Full=Recombination protein U homolog; SW:GN Name=recU; OrderedLocusNames=SPJ_0356; SW:KW Complete proteome; Cytoplasm; DNA damage; DNA recombination;DNA repair; Endonuclease; Hydrolase; Magnesium; Metal-binding;Nuclease. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->198|RECU_STRZJ|e-116|100.0|198/198| GO:SWS:NREP 8 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006974|"GO:response to DNA damage stimulus"|DNA damage| GO:SWS GO:0006310|"GO:DNA recombination"|DNA recombination| GO:SWS GO:0006281|"GO:DNA repair"|DNA repair| GO:SWS GO:0004519|"GO:endonuclease activity"|Endonuclease| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0004518|"GO:nuclease activity"|Nuclease| BL:PDB:NREP 1 BL:PDB:REP 29->188|1y1oA|2e-51|59.1|159/166| RP:PDB:NREP 1 RP:PDB:REP 21->132|2e6nA|6e-16|14.9|101/104| RP:PFM:NREP 1 RP:PFM:REP 26->188|PF03838|7e-50|62.7|158/160|RecU| HM:PFM:NREP 1 HM:PFM:REP 25->190|PF03838|5.9e-73|60.5|162/165|RecU| GO:PFM:NREP 3 GO:PFM GO:0005737|"GO:cytoplasm"|PF03838|IPR004612| GO:PFM GO:0006281|"GO:DNA repair"|PF03838|IPR004612| GO:PFM GO:0006310|"GO:DNA recombination"|PF03838|IPR004612| RP:SCP:NREP 1 RP:SCP:REP 29->190|1rznA|9e-45|51.0|145/150|c.52.1.28| HM:SCP:REP 28->193|1y1oA_|1.2e-60|54.2|166/0|c.52.1.28|1/1|Restriction endonuclease-like| OP:NHOMO 157 OP:NHOMOORG 150 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111211111121211111231111111111111--211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-----------------------1-----11--1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---11--111111111111-11---------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 170 STR:RPRED 85.9 SQ:SECSTR ####################ccccccccHHHHHHHHHHHHHHHccccTTTccccTTcEEEEEETTTcccEEEEEEEEEEEEEEETTEEEEEETTTTEEEEccccEEcTTcEEcccTTTcTTTccccccTHHHEEETTTTEEEEEEHHHHHHHHHHGGcccEEEHHHHHHHcEEccccccccccHHHHHHH######## DISOP:02AL 1-25,197-199| PSIPRED cccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccEEEEEcccccEEEEcccccccccEEEEEEEcccccccEEEEEccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHcccEEEEEEEEEcccEEEEEEHHHHHHHHHHccccccccHHHHHHccEEEcccccccccHHHHHHHHHcccccc //