[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : regR
DDBJ      :regR         sugar binding transcriptional regulator RegR
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  550/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
a.35.1c.93.1
:333 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->332 1zvvA PDBj 2e-33 26.9 %
:RPS:PDB   6->332 1bdhA PDBj 5e-55 26.5 %
:RPS:SCOP  6->61 1bdhA1  a.35.1.5 * 1e-16 45.5 %
:RPS:SCOP  66->332 1rzrA2  c.93.1.1 * 4e-51 23.5 %
:HMM:SCOP  3->62 1efaA1 a.35.1.5 * 6.8e-16 45.8 %
:HMM:SCOP  62->326 1bykA_ c.93.1.1 * 4.5e-45 28.3 %
:RPS:PFM   6->52 PF00356 * LacI 5e-07 47.8 %
:RPS:PFM   66->307 PF00532 * Peripla_BP_1 4e-19 27.8 %
:HMM:PFM   65->242 PF00532 * Peripla_BP_1 2.6e-19 24.4 172/279  
:HMM:PFM   6->52 PF00356 * LacI 7e-18 50.0 46/46  
:BLT:SWISS 6->331 KDGR_BACSU 7e-47 32.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55754.1 GT:GENE regR GT:PRODUCT sugar binding transcriptional regulator RegR GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 288727..289728 GB:FROM 288727 GB:TO 289728 GB:DIRECTION + GB:GENE regR GB:PRODUCT sugar binding transcriptional regulator RegR GB:NOTE Chapuy-Regaud,S.; (2003)Inf.& Imm. 71: 2615-2625; identified by match to protein family HMM PF00356; match to protein family HMM PF00532 GB:PROTEIN_ID ACF55754.1 GB:DB_XREF GI:194357306 GB:GENE:GENE regR LENGTH 333 SQ:AASEQ MEKKLTIKDIAEMAQTSKTTVSFYLNGKYEKMSQETREKIEKVIHETNYKPSIVARSLNSKRTKLIGVLIGDITNSFSNQIVKGIEDIASQNGYQVMIGNSNYSQESEDRYIESMLLLGVDGFIIQPTSNFRKYSRIIDEKKKKMVFFDSQLYEHRTSWVKTNNYDAVYDMTQSCIEKGYEHFLLITADTSRLSTRIERASGFVDALTDANMRHASLTIEDKHTNLEQIKEFLQKEIDPDEKTLVFIPNCWALPLVFTVIKELNYNLPQVGLIGFDNTEWTCFSSPSVSTLVQPSFEEGQQATKILIDQIEGRNQEERQQVLDCSVNWKESTF GT:EXON 1|1-333:0| BL:SWS:NREP 1 BL:SWS:REP 6->331|KDGR_BACSU|7e-47|32.7|324/339| BL:PDB:NREP 1 BL:PDB:REP 5->332|1zvvA|2e-33|26.9|327/332| RP:PDB:NREP 1 RP:PDB:REP 6->332|1bdhA|5e-55|26.5|325/338| RP:PFM:NREP 2 RP:PFM:REP 6->52|PF00356|5e-07|47.8|46/46|LacI| RP:PFM:REP 66->307|PF00532|4e-19|27.8|237/261|Peripla_BP_1| HM:PFM:NREP 2 HM:PFM:REP 65->242|PF00532|2.6e-19|24.4|172/279|Peripla_BP_1| HM:PFM:REP 6->52|PF00356|7e-18|50.0|46/46|LacI| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00356|IPR000843| GO:PFM GO:0005622|"GO:intracellular"|PF00356|IPR000843| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00356|IPR000843| RP:SCP:NREP 2 RP:SCP:REP 6->61|1bdhA1|1e-16|45.5|55/56|a.35.1.5| RP:SCP:REP 66->332|1rzrA2|4e-51|23.5|264/272|c.93.1.1| HM:SCP:REP 3->62|1efaA1|6.8e-16|45.8|59/59|a.35.1.5|1/1|lambda repressor-like DNA-binding domains| HM:SCP:REP 62->326|1bykA_|4.5e-45|28.3|254/255|c.93.1.1|1/1|Periplasmic binding protein-like I| OP:NHOMO 3550 OP:NHOMOORG 555 OP:PATTERN -------------------------------------------------------------------- 6661I-1-557--1-1-----1---7------211111595-143D8-443-GFG-----1-42A38876376775672---3-----1121-2-----1-7-419-83A--------------------------65633---9----------------------1-1-------------42-11A9-97ABBBAB98C7BAA989DDCC88AB858E28568999993O54444444444444432255A571762A314AA6656644796566777966744466666566666565554555666556622266679418D222222292855114679F4241226--------J1-4899A1-2--19663-----3-322--------33233333238---2--31138--CABAIADHGFGA437135954533855--------333-1--1------------------------------231212331466787643222559B5454377782343--6663-411527249----1--3----------------1----1--3------------------2-----------------------------BBE5-77-7385343413321211132115-------------HHEC6GEBAABBCCCAA-AA8ADAAACCABBCD9CDCILIED889DDCCDCDDDDCCDCBCL98AAAAA6-GDDDCCDCDDDD---------------66B444757133334336------1---4633332547133341655----------A898BBBBBBA9EE7787677555-------1----------------4----------1--------------5596239544--- -------------1------------------------------------------------------------------------------------------------------------------------------------------------------------2--1-----------2--------3---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 332 STR:RPRED 99.7 SQ:SECSTR HHccccHHHHHHHHTccHHHHHHHHHTcEccccHHHHHHHHHHHHHHTccccHHHHHHHHTcccEEEEEEcccccHHHHHHHHHHHHHHHHTTcEEEEEEcTTcHHHHHHHHHHHHHTTccEEEEcccccHHHHHHHHTTTTccEEEccccccccccEEEEccHHHHHHHHHHHHHHTTcccEEEEcccTTcHHHHHHHHHHHHHHHHHTTcccGGGcccccccHHHHHHHHHHHHcccccccEEEEccHHHHHHHHHHHHHTTccTTTcEEEEEEccTTGGGccccccEEEccHHHHHHHHHHHHHHHHHTccccccEEEcccEEEccccc# DISOP:02AL 1-2| PSIPRED ccccccHHHHHHHHcccHHHHHHHHccccccccHHHHHHHHHHHHHHcccccHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHccccEEEEEcccccccccEEEEcHHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHHHHHHHHcccccccEEEEcccccHHHHHHHHHHHHccccccEEEEccHHHHHHHHHHHHHcccccccEEEEEEccHHHHHHccccccEEEccHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEEEcccc //