[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : rimM
DDBJ      :rimM         16S rRNA processing protein RimM
Swiss-Prot:RIMM_STRZT   RecName: Full=Ribosome maturation factor rimM;

Homologs  Archaea  0/68 : Bacteria  432/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.41.1b.43.3
:172 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->161 2f1lA PDBj 8e-12 31.1 %
:RPS:PDB   1->170 2dyiA PDBj 4e-34 23.9 %
:RPS:SCOP  2->91 2f1lA2  b.43.3.4 * 2e-14 20.7 %
:RPS:SCOP  99->167 2f1lA1  b.41.1.4 * 7e-14 39.1 %
:HMM:SCOP  2->93 2f1lA2 b.43.3.4 * 1.2e-18 36.0 %
:HMM:SCOP  99->168 2f1lA1 b.41.1.4 * 8.3e-18 42.9 %
:RPS:PFM   5->90 PF01782 * RimM 4e-08 35.7 %
:HMM:PFM   6->90 PF01782 * RimM 1.5e-20 36.1 83/84  
:HMM:PFM   97->167 PF05239 * PRC 9.5e-15 32.8 67/79  
:BLT:SWISS 1->172 RIMM_STRZT 3e-98 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55882.1 GT:GENE rimM GT:PRODUCT 16S rRNA processing protein RimM GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 688589..689107 GB:FROM 688589 GB:TO 689107 GB:DIRECTION + GB:GENE rimM GB:PRODUCT 16S rRNA processing protein RimM GB:NOTE identified by match to protein family HMM PF01782; match to protein family HMM PF05239; match to protein family HMM TIGR02273 GB:PROTEIN_ID ACF55882.1 GB:DB_XREF GI:194357434 GB:GENE:GENE rimM LENGTH 172 SQ:AASEQ MNYFNVGKIVNTQGLQGEMRVLSVTDFAEERFKKGAELALFDEKDQFVQTVTIASHRKQKNFDIIKFKDMYHINTIEKYKGYSLKVAEEDLNDLDDGEFYYHEIIGLEVYEGDSLVGTIKEILQPGANDVWVVKRKGKRDLLLPYIPPVVLNVDIPNKRVDVEILEGLDDED GT:EXON 1|1-172:0| SW:ID RIMM_STRZT SW:DE RecName: Full=Ribosome maturation factor rimM; SW:GN Name=rimM; OrderedLocusNames=SPT_1423; SW:KW Chaperone; Complete proteome; Cytoplasm; Ribosome biogenesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->172|RIMM_STRZT|3e-98|100.0|172/172| GO:SWS:NREP 2 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0042254|"GO:ribosome biogenesis"|Ribosome biogenesis| BL:PDB:NREP 1 BL:PDB:REP 6->161|2f1lA|8e-12|31.1|148/162| RP:PDB:NREP 1 RP:PDB:REP 1->170|2dyiA|4e-34|23.9|155/162| RP:PFM:NREP 1 RP:PFM:REP 5->90|PF01782|4e-08|35.7|84/84|RimM| HM:PFM:NREP 2 HM:PFM:REP 6->90|PF01782|1.5e-20|36.1|83/84|RimM| HM:PFM:REP 97->167|PF05239|9.5e-15|32.8|67/79|PRC| GO:PFM:NREP 1 GO:PFM GO:0006364|"GO:rRNA processing"|PF01782|IPR002676| RP:SCP:NREP 2 RP:SCP:REP 2->91|2f1lA2|2e-14|20.7|87/89|b.43.3.4| RP:SCP:REP 99->167|2f1lA1|7e-14|39.1|69/75|b.41.1.4| HM:SCP:REP 2->93|2f1lA2|1.2e-18|36.0|89/0|b.43.3.4|1/1|Translation proteins| HM:SCP:REP 99->168|2f1lA1|8.3e-18|42.9|70/0|b.41.1.4|1/1|PRC-barrel domain| OP:NHOMO 436 OP:NHOMOORG 432 OP:PATTERN -------------------------------------------------------------------- -1--111-11----111----1--11------1---1111--------1---1111-1--111-11----1----------------1-------------------1-----------------111111--1111--11111111111111-1111111111111111--1-----11--------11-11111111111111211111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111211111211111111111-111111111111111--1111111111111111111111111-11--------1--1----1111--------------------------------1----------------1--111----------------------------------------------------------------------------------------1----------------1---1-------11-----111------1---11111111-1------121------------------------------11111-11----111111---1------1-------11111111-11111111111-1111111111111111111111-111111-1111111-11111-11111111-1--------------11111111-1-----111111-----1111----------1111111111111111111----------111-1111111111--------------111-----------------1-------------------------111111-111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 170 STR:RPRED 98.8 SQ:SECSTR ccEEEEEEEEEEccccccEEEEEGGGGccEEEETTTEEEEEEETccEEEEEEEEEEEEETTEEEEEETTcccHHHHHTTTTcEEEEEGGGcccccTTcccHHHHTTcEEEETTEEEEEEEEEEEETTEEEEEEEGGGcTTEEEETcccTcTTEEEccccEEEcccTTTcc## DISOP:02AL 171-173| PSIPRED ccEEEEEEEEcccEEEEEEEEEEEcccHHHHHccccEEEEEEcccccEEEEEEEEEEEEccEEEEEEcccccHHHHHHHcccEEEEEHHHccccccccEEEEEEEccEEEEccEEEEEEEEEEEccccEEEEEEccccEEEEEEcHHHEEccEEccccEEEEEccccccccc //