[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : rnc
DDBJ      :rnc          ribonuclease III
Swiss-Prot:RNC_STRR6    RecName: Full=Ribonuclease 3;         EC=3.1.26.3;AltName: Full=Ribonuclease III;         Short=RNase III;

Homologs  Archaea  9/68 : Bacteria  884/915 : Eukaryota  121/199 : Viruses  2/175   --->[See Alignment]
a.149.1d.50.1
:232 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->211 1o0wB PDBj 1e-38 44.4 %
:RPS:PDB   1->224 3c4bA PDBj 2e-40 28.7 %
:RPS:SCOP  1->151 1o0wA1  a.149.1.1 * 3e-39 42.0 %
:RPS:SCOP  160->226 1o0wA2  d.50.1.1 * 3e-19 47.8 %
:HMM:SCOP  1->164 1o0wA1 a.149.1.1 * 2.4e-49 45.6 %
:HMM:SCOP  115->227 1whnA_ d.50.1.1 * 1.3e-21 42.9 %
:RPS:PFM   44->132 PF00636 * Ribonuclease_3 2e-16 48.3 %
:RPS:PFM   162->226 PF00035 * dsrm 2e-12 53.1 %
:HMM:PFM   44->133 PF00636 * Ribonuclease_3 5.9e-25 44.4 90/105  
:HMM:PFM   161->226 PF00035 * dsrm 4.5e-20 50.8 65/67  
:BLT:SWISS 1->232 RNC_STRR6 e-124 100.0 %
:PROS 44->52|PS00517|RNASE_3_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56212.1 GT:GENE rnc GT:PRODUCT ribonuclease III GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1118765..1119463) GB:FROM 1118765 GB:TO 1119463 GB:DIRECTION - GB:GENE rnc GB:PRODUCT ribonuclease III GB:NOTE identified by match to protein family HMM PF00035; match to protein family HMM PF00636; match to protein family HMM TIGR02191 GB:PROTEIN_ID ACF56212.1 GB:DB_XREF GI:194357764 GB:GENE:GENE rnc LENGTH 232 SQ:AASEQ MKELQTVLKNHFEIEFADKKLLETAFTHTSYANEHRLLKISHNERLEFLGDAVLQLLISEYLYKKYPKKPEGDLSKLRAMIVREESLAGFARDCQFDQFIKLGKGEEKSGGRNRDTILGDAFEAFLGALLLDKDVAKVKEFIYQVMIPKVEAGEFEMITDYKTHLQELLQVNGDVAIRYQVISETGPAHDKVFDVEVLVEGKSIGQGQGRSKKLAEQEAAKNAVEKGLDSCI GT:EXON 1|1-232:0| SW:ID RNC_STRR6 SW:DE RecName: Full=Ribonuclease 3; EC=3.1.26.3;AltName: Full=Ribonuclease III; Short=RNase III; SW:GN Name=rnc; OrderedLocusNames=spr1127; SW:KW Complete proteome; Cytoplasm; Endonuclease; Hydrolase; Nuclease;RNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->232|RNC_STRR6|e-124|100.0|232/232| GO:SWS:NREP 5 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0004519|"GO:endonuclease activity"|Endonuclease| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0004518|"GO:nuclease activity"|Nuclease| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| PROS 44->52|PS00517|RNASE_3_1|PDOC00448| SEG 63->70|ykkypkkp| BL:PDB:NREP 1 BL:PDB:REP 14->211|1o0wB|1e-38|44.4|196/239| RP:PDB:NREP 1 RP:PDB:REP 1->224|3c4bA|2e-40|28.7|209/238| RP:PFM:NREP 2 RP:PFM:REP 44->132|PF00636|2e-16|48.3|89/93|Ribonuclease_3| RP:PFM:REP 162->226|PF00035|2e-12|53.1|64/66|dsrm| HM:PFM:NREP 2 HM:PFM:REP 44->133|PF00636|5.9e-25|44.4|90/105|Ribonuclease_3| HM:PFM:REP 161->226|PF00035|4.5e-20|50.8|65/67|dsrm| GO:PFM:NREP 5 GO:PFM GO:0003723|"GO:RNA binding"|PF00636|IPR000999| GO:PFM GO:0004525|"GO:ribonuclease III activity"|PF00636|IPR000999| GO:PFM GO:0006396|"GO:RNA processing"|PF00636|IPR000999| GO:PFM GO:0003725|"GO:double-stranded RNA binding"|PF00035|IPR001159| GO:PFM GO:0005622|"GO:intracellular"|PF00035|IPR001159| RP:SCP:NREP 2 RP:SCP:REP 1->151|1o0wA1|3e-39|42.0|150/169|a.149.1.1| RP:SCP:REP 160->226|1o0wA2|3e-19|47.8|67/69|d.50.1.1| HM:SCP:REP 1->164|1o0wA1|2.4e-49|45.6|160/169|a.149.1.1|1/1|RNase III domain-like| HM:SCP:REP 115->227|1whnA_|1.3e-21|42.9|91/0|d.50.1.1|1/1|dsRNA-binding domain-like| OP:NHOMO 1079 OP:NHOMOORG 1016 OP:PATTERN --------------------------------1-----111111--11-------------------- -11-111111111111111-11111111111111111111111111111111111111111111-1-111111111111111111111111111111--11111111111111111111111111111111111111111111111111-2221111-----122-1222111-111111111-----11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11--1111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111--111111111111111-111111111111111111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 -----11-------1-1---1111-1-111111-1-1111111111-1---------------11111-112111211111111-121----1------------1----21-12121111-1-231414C2-31511111111-11111211311111132211211113122-1---------1331-1---1-221 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--- STR:NPRED 229 STR:RPRED 98.7 SQ:SECSTR TTTHHHHHHHHHTcccccHHHHHHHHccTTcTTccccccccccHHHHHHHHHHHHHHHHHHHHHcTTcccHHHHHHHHHHHccHHHHHHHHHHTTGGGTcccccHHHHHcccccccHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHcTTTEEEcccEEcEcTTccEccTTccEEEEEEETTTEEEEEEEccHHHHHHHHHHHHHHH#HHc## DISOP:02AL 1-4,103-116,232-233| PSIPRED cHHHHHHHHHHHccccccHHHHHHHHHcHHHccHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccHHHHHHHHHHccHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccHHHHcccHHHHHHHHHHHHcccccEEEEEEEcccccccEEEEEEEEccEEEEEEEEccHHHHHHHHHHHHHHHHHHccc //