[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : rnr
DDBJ      :rnr          ribonuclease R
Swiss-Prot:             

Homologs  Archaea  13/68 : Bacteria  776/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:784 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   260->573 2vnuD PDBj 2e-38 34.7 %
:BLT:PDB   621->698 2eqsA PDBj 2e-04 34.6 %
:RPS:PDB   15->132 2a8vA PDBj 2e-13 18.9 %
:RPS:PDB   162->707 3bzcA PDBj 1e-62 11.7 %
:RPS:SCOP  60->132 1wfqA  b.40.4.5 * 3e-11 21.1 %
:RPS:SCOP  135->223 2id0A2  b.40.4.5 * 4e-08 14.1 %
:RPS:SCOP  234->622 2id0A4  b.40.4.16 * e-111 25.1 %
:RPS:SCOP  624->704 2id0A1  b.40.4.5 * 2e-14 18.8 %
:HMM:SCOP  50->129 1wfqA_ b.40.4.5 * 4.9e-05 21.2 %
:HMM:SCOP  622->717 1go3E1 b.40.4.5 * 1e-16 33.7 %
:RPS:PFM   70->130 PF08206 * OB_RNB 8e-05 37.3 %
:RPS:PFM   250->574 PF00773 * RNB 1e-89 52.3 %
:RPS:PFM   624->704 PF00575 * S1 8e-05 35.7 %
:HMM:PFM   250->576 PF00773 * RNB 7.9e-111 43.8 313/326  
:HMM:PFM   70->127 PF08206 * OB_RNB 8.5e-20 36.2 58/58  
:HMM:PFM   624->702 PF00575 * S1 3.5e-15 34.8 69/74  
:BLT:SWISS 1->712 RNR1_LACLA 0.0 54.4 %
:PROS 546->570|PS01175|RIBONUCLEASE_II
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55844.1 GT:GENE rnr GT:PRODUCT ribonuclease R GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 866112..868466 GB:FROM 866112 GB:TO 868466 GB:DIRECTION + GB:GENE rnr GB:PRODUCT ribonuclease R GB:NOTE also known as vacB; identified by match to protein family HMM PF00575; match to protein family HMM PF00773; match to protein family HMM PF08206; match to protein family HMM TIGR00358; match to protein family HMM TIGR02063 GB:PROTEIN_ID ACF55844.1 GB:DB_XREF GI:194357396 GB:GENE:GENE rnr LENGTH 784 SQ:AASEQ MKDRIKEYLQDKGKVTVNDLAQALGKDSSKDFRELIKTLSLMERKHQIRFEEDGSLTLEAKKKHEITLKGIFHAHKNGFGFVSLEGEEDDLFVGKNDVNYAIDGDTVEVVIKKVADRNKGTAAEAKIIDILEHSLTTVVGQIVLDQEKPKYAGYIRSKNQKISQPIYVKKPALKLEGTEVLKVFIDKYPSKKHDFFVASVLDVVGHSTDVGIDVLEVLESMDIVSEFPEAVVKEAESVPDAPSQKDMEGRLDLRDEITFTIDGADAKDLDDAVHIKALKNGNLELGVHIADVSYYVTEGSALDKEALNRATSVYVTDRVVPMLPERLSNGICSLNPQVDRLTQSAIMEIDKHGRVVNYTITQTVIKTSFRMTYSDVNDILAGDEEKRKEYHKIVPSIELMAKLHETLENMRVKRGALNFDTNEAKILVDKQGKPVDIVLRQRGIAERMIESFMLMANETVAEHFSKLDLPFIYRIHEEPKAEKVQKFIDYASSFGLRIYGTASEISQEALQDIMRAVEGEPYADVLSMMLLRSMQQARYSEHNHGHYGLAADYYTHFTSPIRRYPDLLVHRMIRDYGRSKEIAEHFEQVIPEIATQSSNRERRAIEAEREVEAMKKAEYMEEYVGEEYDAVVSSIVKFGLFVELPNTVEGLIHITNLPEFYHFNERDLTLRGEKSGITFRVGQQIRIRVERADKMTGEIDFSFVPSEFDVIEKGLKQSSHSGRGRGSNRRSDKKEDKRKSGRSNDKRKHSQKDKKKKGKKPFYKEVAKKGAKHGKGRGKGRRTK GT:EXON 1|1-784:0| BL:SWS:NREP 1 BL:SWS:REP 1->712|RNR1_LACLA|0.0|54.4|712/817| PROS 546->570|PS01175|RIBONUCLEASE_II|PDOC00904| SEG 600->613|rerraieaerevea| SEG 718->743|sshsgrgrgsnrrsdkkedkrksgrs| SEG 746->782|krkhsqkdkkkkgkkpfykevakkgakhgkgrgkgrr| BL:PDB:NREP 2 BL:PDB:REP 260->573|2vnuD|2e-38|34.7|300/676| BL:PDB:REP 621->698|2eqsA|2e-04|34.6|78/103| RP:PDB:NREP 2 RP:PDB:REP 15->132|2a8vA|2e-13|18.9|111/118| RP:PDB:REP 162->707|3bzcA|1e-62|11.7|532/730| RP:PFM:NREP 3 RP:PFM:REP 70->130|PF08206|8e-05|37.3|59/60|OB_RNB| RP:PFM:REP 250->574|PF00773|1e-89|52.3|321/327|RNB| RP:PFM:REP 624->704|PF00575|8e-05|35.7|70/74|S1| HM:PFM:NREP 3 HM:PFM:REP 250->576|PF00773|7.9e-111|43.8|313/326|RNB| HM:PFM:REP 70->127|PF08206|8.5e-20|36.2|58/58|OB_RNB| HM:PFM:REP 624->702|PF00575|3.5e-15|34.8|69/74|S1| GO:PFM:NREP 3 GO:PFM GO:0003723|"GO:RNA binding"|PF00773|IPR001900| GO:PFM GO:0004540|"GO:ribonuclease activity"|PF00773|IPR001900| GO:PFM GO:0003723|"GO:RNA binding"|PF00575|IPR003029| RP:SCP:NREP 4 RP:SCP:REP 60->132|1wfqA|3e-11|21.1|71/89|b.40.4.5| RP:SCP:REP 135->223|2id0A2|4e-08|14.1|85/90|b.40.4.5| RP:SCP:REP 234->622|2id0A4|e-111|25.1|379/381|b.40.4.16| RP:SCP:REP 624->704|2id0A1|2e-14|18.8|80/87|b.40.4.5| HM:SCP:REP 50->129|1wfqA_|4.9e-05|21.2|80/0|b.40.4.5|1/1|Nucleic acid-binding proteins| HM:SCP:REP 622->717|1go3E1|1e-16|33.7|95/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 1678 OP:NHOMOORG 986 OP:PATTERN ------------------------11111111-----------11-11----1--------------- 212-11--111---1---------------------1132-----11--------11---------11----------1-11111111111111111--1111111111111111111111111222111111111----------743322222222112112222222212111112112122222---1111111111111111111111111111111111111111111111111111111111111111111111111111111111111222111111111111111111111111111111111111111111111111111111111111111111111111111-1-----111111111-11-11111111111111111111111111111111111-11112111111-11111111111111111111111111111111111111-1111------------------------------1111111111111111111111111111111111121122111111111223111111111222222222111111111122211221121111111111111122-11111111111111111111111111112221221122211111111111111111112-1111-21122222222222222222222-2222222222222222222222222222222222222222222222222222-222222222222--2111111111111321222222222122222111111111112111111111111111112222222221222222222132221111111111111112-2111111--------1-1----1-11111111111111111111111111111-11 3422552-82223333222223223223222223222222222222222222222122222232233212232323323332222234-24322222323222998134596644594233344D9273DT537563323443342342544354444432235722422222422134P4444433252343243441 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 690 STR:RPRED 88.0 SQ:SECSTR ############ccccHHHHHTccHHHHHHHHHTTTcccGGGccHHHHHHHHHHHHHTHHHTTccEEEEEEEEEcTTccEEEEcTccTTcEEEcHHHHHHHcTTcEEEEEEEcccTTccEEEEcEEEEEETcETTcccccEE#############EEETTEcccccccccHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHcEEEEEEcGGGcGGGGGGGGGcEEEEEGGGccHHHHHHHHTccccccEEEEEEEEEEcccccTTcccHHHHHHHHHTTHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHTccccccccEEEEEccccccEEEEEEcTTccEccGGGccHHHHHHHHHHHHHHHTccEEEEEHHHHHcGGGccEEEEEccHHHHHHHHcHHHHHHcTTccHHHHHHHHHHHHHHcHHHHHTTccGGGGTccTTGGGccHHHHHHHHHHHHHHHHHHHcEETTTccHHHHHTcTTccHHHHHHHcccccGGGGGGcTTccHHHHHHHGGGEEcTTcccGGGGccccGGGHHHHHHHHHHHTccHHHHTTcHHHccGGGTccccccHHHHHHHHHHHHcTTccccccccTTTTcccccccTTccTTcccccEEEEEETTEEEEEcccccEEEEETTTccccccccccccEEEEccHHHHccTTccccccEEEEETTTTEEEEccccccTHHHHHcc##################################################################### DISOP:02AL 115-122,704-785| PSIPRED cHHHHHHHHHHcccccHHHHHHHcccccHHHHHHHHHHHHHHHHcccEEEEccccEEEcccccccEEEEEEEEEccccEEEEEEccccccEEEcHHHHHccccccEEEEEEEccccccccccccEEEEEEEEccccEEEEEEEEccccccEEEEEEcccccccccEEccccccccccccEEEEEEEEccccccccEEEEEEEEcccccccccHHHHHHHHccccccccHHHHHHHHHccccccHHHHcccccHHcccEEEEcccccEEcccEEEEEEcccccEEEEEEEccHHHHcccccHHHHHHHHcccEEEccccccccccHHHHHHHHHcccccEEEEEEEEEEEcccccEEEEEEEEEEEEccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEcccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHccccEEEcccccccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHcccEEccccccccccccccHHHHcccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEEccEEEEEEccccEEEEEcccccccEEEcccccEEEEccccEEEEcccEEEEEEEEEEccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //