[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : rpe
DDBJ      :rpe          ribulose-phosphate 3-epimerase
Swiss-Prot:             

Homologs  Archaea  14/68 : Bacteria  876/915 : Eukaryota  190/199 : Viruses  0/175   --->[See Alignment]
c.1.2c.55.3d.52.1
:218 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->218 2fliG PDBj 1e-79 65.4 %
:RPS:PDB   5->214 1ad1A PDBj 1e-29 12.0 %
:RPS:SCOP  1->170 1xhxA1  c.55.3.5 * 1e-35 14.1 %
:RPS:SCOP  156->197 2proA2  d.52.1.1 * 7e-10 14.3 %
:HMM:SCOP  3->218 2fliA1 c.1.2.2 * 7.8e-69 44.4 %
:RPS:PFM   6->202 PF00834 * Ribul_P_3_epim 4e-68 59.4 %
:HMM:PFM   5->203 PF00834 * Ribul_P_3_epim 8.5e-79 48.7 199/201  
:BLT:SWISS 5->204 RPE_RHOCA 7e-58 55.3 %
:PROS 135->157|PS01086|RIBUL_P_3_EPIMER_2

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55083.1 GT:GENE rpe GT:PRODUCT ribulose-phosphate 3-epimerase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1797476..1798132) GB:FROM 1797476 GB:TO 1798132 GB:DIRECTION - GB:GENE rpe GB:PRODUCT ribulose-phosphate 3-epimerase GB:NOTE identified by match to protein family HMM PF00834; match to protein family HMM TIGR01163 GB:PROTEIN_ID ACF55083.1 GB:DB_XREF GI:194356635 GB:GENE:GENE rpe LENGTH 218 SQ:AASEQ MSQYKIAPSILAADYANFEREIKRLEATGAEYAHIDIMDSHFVPQISFGAGVVESLRPHSKMVFDCHLMVSNPEHHLEDFARAGADIISIHVEATPHIHGALQKIRLLGVKPSVVINPGTPVEAIKHVLHLVDQVLVMTVNPGFGGQAFLPETMDKVRELVALREEKGLNFEIEVDGGIDDQTIAQAKEAGATVFVAGSYVFKGEVNERVQTLRKQLD GT:EXON 1|1-218:0| BL:SWS:NREP 1 BL:SWS:REP 5->204|RPE_RHOCA|7e-58|55.3|197/228| PROS 135->157|PS01086|RIBUL_P_3_EPIMER_2|PDOC00833| BL:PDB:NREP 1 BL:PDB:REP 2->218|2fliG|1e-79|65.4|217/218| RP:PDB:NREP 1 RP:PDB:REP 5->214|1ad1A|1e-29|12.0|208/264| RP:PFM:NREP 1 RP:PFM:REP 6->202|PF00834|4e-68|59.4|197/201|Ribul_P_3_epim| HM:PFM:NREP 1 HM:PFM:REP 5->203|PF00834|8.5e-79|48.7|199/201|Ribul_P_3_epim| GO:PFM:NREP 2 GO:PFM GO:0004750|"GO:ribulose-phosphate 3-epimerase activity"|PF00834|IPR000056| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF00834|IPR000056| RP:SCP:NREP 2 RP:SCP:REP 1->170|1xhxA1|1e-35|14.1|163/183|c.55.3.5| RP:SCP:REP 156->197|2proA2|7e-10|14.3|42/61|d.52.1.1| HM:SCP:REP 3->218|2fliA1|7.8e-69|44.4|216/0|c.1.2.2|1/1|Ribulose-phoshate binding barrel| OP:NHOMO 1395 OP:NHOMOORG 1080 OP:PATTERN -----------------------------1-----11111111------------------111--11 1111111111111111111-1111111111111111111111221111112111111111111111111111111111111111111111111211---1111111111111111111111111111111111111111111121111111111111111211111111111111111111111111111111111111111111111111112111111111115556541111111111111111111111111112111111111211211111221211111111211112212121111111111111111111111211114111111111113111111111112211121111111111121111111111111111112121111111211111111111-11111111121131111112222211111111111111111111111211111211111111111---------------1111111111111111111111111111111111111122132111112211112112111111111111111111111111111111111111111111111111111111111-1111111111111111111111111131111111111111111111111111111-1111111111121111113112322211-1332222121132333332313111113133333344333333111111111111111111111111111111111111111111111111121112211111111111111111111111111111111111111111111111111211111111111111111111111111--------111----2-112211-111121111--11111111111221 11--11--52111111111111111111112221111111111111111111111111111111111111111-11111111111111-1111112111111111111612211112212111233142GI3-321212321212221111223-111222412111111-11113213a3433142531523222134 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 218 STR:RPRED 100.0 SQ:SECSTR HTTcGcccTTTTccHHHHHHHHHHHHHTTccEEEEEccccccccHHHHHHHHHHHHHHHTTcccEEEEEcccHHGHHHHHHHTTccEEEEETTTTcccTHHHHHHHHTTcEEEEEccccTTcHHHHHHHHTTccGGGEEEEccTTccccHHHHHHHHHcHHHHHTTcHHHHTTccccccGGGGHHHHHHHHHHHHHHTccEEEccHHHHHHHHHHHcH DISOP:02AL 1-3,218-219| PSIPRED ccccEEEHHHHHccHHHHHHHHHHHHHccccEEEEEEEEccccccccccHHHHHHHHcccccEEEEEEccccHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHccEEEEEEEcccccHHHccHHHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHccccEEEEEEHHHcccHHHHHHHHHHHcc //