[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : rpmA
DDBJ      :rpmA         50S ribosomal protein L27
Swiss-Prot:RL27_STRZT   RecName: Full=50S ribosomal protein L27;

Homologs  Archaea  0/68 : Bacteria  899/915 : Eukaryota  96/199 : Viruses  0/175   --->[See Alignment]
b.84.4
:97 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->96 2wdi0 PDBj 8e-25 63.1 %
:RPS:PDB   13->96 3bboX PDBj 4e-26 52.4 %
:RPS:SCOP  13->94 1vs6W1  b.84.4.1 * 6e-26 58.5 %
:HMM:SCOP  31->96 1v8qA_ b.84.4.1 * 7.3e-22 56.1 %
:RPS:PFM   13->92 PF01016 * Ribosomal_L27 1e-21 67.5 %
:HMM:PFM   13->93 PF01016 * Ribosomal_L27 1.3e-37 60.5 81/81  
:BLT:SWISS 1->97 RL27_STRZT 7e-53 100.0 %
:PROS 45->59|PS00831|RIBOSOMAL_L27

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56038.1 GT:GENE rpmA GT:PRODUCT 50S ribosomal protein L27 GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 983138..983431 GB:FROM 983138 GB:TO 983431 GB:DIRECTION + GB:GENE rpmA GB:PRODUCT 50S ribosomal protein L27 GB:NOTE identified by match to protein family HMM PF01016; match to protein family HMM TIGR00062 GB:PROTEIN_ID ACF56038.1 GB:DB_XREF GI:194357590 GB:GENE:GENE rpmA LENGTH 97 SQ:AASEQ MLKMTLNNLQLFAHKKGGGSTSNGRDSQAKRLGAKAADGQTVTGGSILYRQRGTHIYPGVNVGRGGDDTLFAKVEGVVRFERKGRDKKQVSVYPIAK GT:EXON 1|1-97:0| SW:ID RL27_STRZT SW:DE RecName: Full=50S ribosomal protein L27; SW:GN Name=rpmA; OrderedLocusNames=SPT_1153; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->97|RL27_STRZT|7e-53|100.0|97/97| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 45->59|PS00831|RIBOSOMAL_L27|PDOC00652| BL:PDB:NREP 1 BL:PDB:REP 13->96|2wdi0|8e-25|63.1|84/84| RP:PDB:NREP 1 RP:PDB:REP 13->96|3bboX|4e-26|52.4|84/86| RP:PFM:NREP 1 RP:PFM:REP 13->92|PF01016|1e-21|67.5|80/81|Ribosomal_L27| HM:PFM:NREP 1 HM:PFM:REP 13->93|PF01016|1.3e-37|60.5|81/81|Ribosomal_L27| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01016|IPR001684| GO:PFM GO:0005622|"GO:intracellular"|PF01016|IPR001684| GO:PFM GO:0005840|"GO:ribosome"|PF01016|IPR001684| GO:PFM GO:0006412|"GO:translation"|PF01016|IPR001684| RP:SCP:NREP 1 RP:SCP:REP 13->94|1vs6W1|6e-26|58.5|82/84|b.84.4.1| HM:SCP:REP 31->96|1v8qA_|7.3e-22|56.1|66/66|b.84.4.1|1/1|Ribosomal L27 protein| OP:NHOMO 1035 OP:NHOMOORG 995 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111-1111111111111111111--1-----1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111-11-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 11--111-1-----1--111111111-------111-111111---11--------------11111111111111111111111111-12--1111-11--11-2-12--1-1-------------1----------------1--------------------1-------112222D33322342114211211-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 89 STR:RPRED 91.8 SQ:SECSTR #######EEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc# DISOP:02AL 1-2,13-31| PSIPRED cccHHHccEEEEEEEcccccccccccccccEEEEEEEccEEEccccEEEEccccEEEcccccccccccEEEEEEccEEEEEEEcccccEEEEEEccc //