[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : rpmB
DDBJ      :rpmB         ribosomal protein L28
Swiss-Prot:RL28_STRZT   RecName: Full=50S ribosomal protein L28;

Homologs  Archaea  0/68 : Bacteria  151/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.325.1
:62 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->61 2jz6A PDBj 1e-08 44.3 %
:RPS:PDB   3->56 3bboY PDBj 3e-11 31.5 %
:RPS:SCOP  1->62 2zjpU1  d.325.1.1 * 3e-14 25.8 %
:HMM:SCOP  1->62 2j0111 d.325.1.1 * 9.5e-21 45.2 %
:RPS:PFM   3->47 PF00830 * Ribosomal_L28 1e-05 51.1 %
:HMM:PFM   3->57 PF00830 * Ribosomal_L28 1.3e-21 43.6 55/61  
:BLT:SWISS 1->62 RL28_STRZT 4e-32 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54926.1 GT:GENE rpmB GT:PRODUCT ribosomal protein L28 GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 393085..393273 GB:FROM 393085 GB:TO 393273 GB:DIRECTION + GB:GENE rpmB GB:PRODUCT ribosomal protein L28 GB:NOTE identified by match to protein family HMM PF00830; match to protein family HMM TIGR00009 GB:PROTEIN_ID ACF54926.1 GB:DB_XREF GI:194356478 GB:GENE:GENE rpmB LENGTH 62 SQ:AASEQ MAKVCYFTGRKTVSGNNRSHAMNQTKRAVKPNLQKVTVLIDGKPKKVWASARALKSGKVERV GT:EXON 1|1-62:0| SW:ID RL28_STRZT SW:DE RecName: Full=50S ribosomal protein L28; SW:GN Name=rpmB; OrderedLocusNames=SPT_0478; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->62|RL28_STRZT|4e-32|100.0|62/62| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| BL:PDB:NREP 1 BL:PDB:REP 1->61|2jz6A|1e-08|44.3|61/77| RP:PDB:NREP 1 RP:PDB:REP 3->56|3bboY|3e-11|31.5|54/76| RP:PFM:NREP 1 RP:PFM:REP 3->47|PF00830|1e-05|51.1|45/61|Ribosomal_L28| HM:PFM:NREP 1 HM:PFM:REP 3->57|PF00830|1.3e-21|43.6|55/61|Ribosomal_L28| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00830|IPR001383| GO:PFM GO:0005622|"GO:intracellular"|PF00830|IPR001383| GO:PFM GO:0005840|"GO:ribosome"|PF00830|IPR001383| GO:PFM GO:0006412|"GO:translation"|PF00830|IPR001383| RP:SCP:NREP 1 RP:SCP:REP 1->62|2zjpU1|3e-14|25.8|62/72|d.325.1.1| HM:SCP:REP 1->62|2j0111|9.5e-21|45.2|62/0|d.325.1.1|1/1|L28p-like| OP:NHOMO 151 OP:NHOMOORG 151 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1---1--1----------------------------------------------------------------------------------------------------------11111111111111111111111111111111111111111-1111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111-1--------------1--1--------1---1111----1-1--------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1----------------1-----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-----------------------1----------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 61 STR:RPRED 98.4 SQ:SECSTR ccccccccccTTccccccEEcccccccEEccccccccccccccccccccccccTTTccccc# DISOP:02AL 1-1,62-63| PSIPRED cccEEEEEcccccccccHHHHHHccccEEcccEEEEEEEEccEEEEEEEEEHHHccccEEEc //