[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : rpmC
DDBJ      :rpmC         ribosomal protein L29
Swiss-Prot:RL29_STRZT   RecName: Full=50S ribosomal protein L29;

Homologs  Archaea  0/68 : Bacteria  256/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.2.2
:68 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->66 2zjrV PDBj 2e-10 45.5 %
:RPS:PDB   1->66 3d5b2 PDBj 2e-09 51.5 %
:RPS:SCOP  11->66 1vs6X1  a.2.2.1 * 3e-11 50.0 %
:HMM:SCOP  8->70 1r73A_ a.2.2.1 * 6.7e-16 57.1 %
:RPS:PFM   10->66 PF00831 * Ribosomal_L29 2e-05 70.2 %
:HMM:PFM   10->66 PF00831 * Ribosomal_L29 7.7e-28 64.9 57/58  
:BLT:SWISS 1->68 RL29_STRZT 8e-33 100.0 %
:PROS 46->60|PS00579|RIBOSOMAL_L29

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54927.1 GT:GENE rpmC GT:PRODUCT ribosomal protein L29 GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 197406..197612 GB:FROM 197406 GB:TO 197612 GB:DIRECTION + GB:GENE rpmC GB:PRODUCT ribosomal protein L29 GB:NOTE identified by match to protein family HMM PF00831; match to protein family HMM TIGR00012 GB:PROTEIN_ID ACF54927.1 GB:DB_XREF GI:194356479 GB:GENE:GENE rpmC LENGTH 68 SQ:AASEQ MKLNEVKEFVKELRGLSQEELAKRENELKKELFELRFQAATGQLEQTARLKEVKKQIARIKTVQSEAK GT:EXON 1|1-68:0| SW:ID RL29_STRZT SW:DE RecName: Full=50S ribosomal protein L29; SW:GN Name=rpmC; OrderedLocusNames=SPT_0264; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->68|RL29_STRZT|8e-33|100.0|68/68| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 46->60|PS00579|RIBOSOMAL_L29|PDOC00501| BL:PDB:NREP 1 BL:PDB:REP 12->66|2zjrV|2e-10|45.5|55/66| RP:PDB:NREP 1 RP:PDB:REP 1->66|3d5b2|2e-09|51.5|66/72| RP:PFM:NREP 1 RP:PFM:REP 10->66|PF00831|2e-05|70.2|57/58|Ribosomal_L29| HM:PFM:NREP 1 HM:PFM:REP 10->66|PF00831|7.7e-28|64.9|57/58|Ribosomal_L29| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00831|IPR001854| GO:PFM GO:0005622|"GO:intracellular"|PF00831|IPR001854| GO:PFM GO:0005840|"GO:ribosome"|PF00831|IPR001854| GO:PFM GO:0006412|"GO:translation"|PF00831|IPR001854| RP:SCP:NREP 1 RP:SCP:REP 11->66|1vs6X1|3e-11|50.0|56/63|a.2.2.1| HM:SCP:REP 8->70|1r73A_|6.7e-16|57.1|63/0|a.2.2.1|1/1|Ribosomal protein L29 (L29p)| OP:NHOMO 257 OP:NHOMOORG 256 OP:PATTERN -------------------------------------------------------------------- ------1-111-111--11-1111-111111--111-1--111---------111--------1-1---1--------1-11------------------------------------------------------1--------------------1----------------1----------------11111111-11111111111111111111111111111111-1-------------------111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111---11111111111-1-11111-------111121--1--1111111111-11111111111-1111111111--1--1-1-111--1111-11-----------------------1--------------11--------------11111------------------------------------------------------------------------11------11--------11--1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 68 STR:RPRED 100.0 SQ:SECSTR cHHHHHHHHHHTTTTcTHHHHHHHHHHHHHHHHHHHHHHHHcTTccTTHHHHHHHHHHHHHHHHHHHH DISOP:02AL 1-6,66-69| PSIPRED ccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcc //