[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : rpmD
DDBJ      :rpmD         ribosomal protein L30
Swiss-Prot:RL30_STRZT   RecName: Full=50S ribosomal protein L30;

Homologs  Archaea  0/68 : Bacteria  323/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.59.1
:60 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->58 1vs6Y PDBj 4e-12 54.5 %
:RPS:PDB   1->59 1bxyA PDBj 7e-16 45.8 %
:RPS:SCOP  1->59 1bxyA  d.59.1.1 * 4e-16 45.8 %
:HMM:SCOP  1->60 1bxyA_ d.59.1.1 * 1.3e-18 51.7 %
:RPS:PFM   4->54 PF00327 * Ribosomal_L30 2e-08 54.9 %
:HMM:PFM   4->54 PF00327 * Ribosomal_L30 4.8e-22 41.2 51/52  
:BLT:SWISS 1->60 RL30_STRZT 2e-28 100.0 %
:PROS 22->54|PS00634|RIBOSOMAL_L30

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55934.1 GT:GENE rpmD GT:PRODUCT ribosomal protein L30 GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 201904..202086 GB:FROM 201904 GB:TO 202086 GB:DIRECTION + GB:GENE rpmD GB:PRODUCT ribosomal protein L30 GB:NOTE identified by match to protein family HMM PF00327; match to protein family HMM TIGR01308 GB:PROTEIN_ID ACF55934.1 GB:DB_XREF GI:194357486 GB:GENE:GENE rpmD LENGTH 60 SQ:AASEQ MAQIKITLTKSPIGRIPSQRKTVVALGLGKLNSSVIKEDNAAIRGMITAVSHLVTVEEVN GT:EXON 1|1-60:0| SW:ID RL30_STRZT SW:DE RecName: Full=50S ribosomal protein L30; SW:GN Name=rpmD; OrderedLocusNames=SPT_0274; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->60|RL30_STRZT|2e-28|100.0|60/60| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 22->54|PS00634|RIBOSOMAL_L30|PDOC00551| BL:PDB:NREP 1 BL:PDB:REP 4->58|1vs6Y|4e-12|54.5|55/58| RP:PDB:NREP 1 RP:PDB:REP 1->59|1bxyA|7e-16|45.8|59/60| RP:PFM:NREP 1 RP:PFM:REP 4->54|PF00327|2e-08|54.9|51/52|Ribosomal_L30| HM:PFM:NREP 1 HM:PFM:REP 4->54|PF00327|4.8e-22|41.2|51/52|Ribosomal_L30| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00327|IPR000517| GO:PFM GO:0005622|"GO:intracellular"|PF00327|IPR000517| GO:PFM GO:0005840|"GO:ribosome"|PF00327|IPR000517| GO:PFM GO:0006412|"GO:translation"|PF00327|IPR000517| RP:SCP:NREP 1 RP:SCP:REP 1->59|1bxyA|4e-16|45.8|59/60|d.59.1.1| HM:SCP:REP 1->60|1bxyA_|1.3e-18|51.7|60/60|d.59.1.1|1/1|Ribosomal protein L30p/L7e| OP:NHOMO 323 OP:NHOMOORG 323 OP:PATTERN -------------------------------------------------------------------- ----1-1-------1--11-11---111111-1111111111111111111---------11-111-1111----111--1-1----------------1-------1-------------------1-1-1----11111111-----------------------------------------------1111111111111111111111111111111111111111111111111111111111111111111111111111111111--111111111111111111111111111111111111111111111111-11------------11111---1--1--1-1-111111--1----------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------1------------------1----------------------------1--------------------------------------1------11----1--1--1----------11111111111111111-11-1111111111111111111111111111111111111111111111111111-1111111--111---------111---1------------------------------------------------------------1111111111-----------------1----------------11-1-----------------------1-11111-1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 59 STR:RPRED 98.3 SQ:SECSTR ccEEEEEEccccTTccHHHHHHHHHHTcccTTcEEEEEccHHHHHHHHHTTTTEEEEEE# DISOP:02AL 1-1| PSIPRED cccEEEEEEEccccccHHHHHHHHHHcccccccEEEEcccHHHHHHHHHHHHHEEEEEcc //