[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : rpmE
DDBJ      :rpmE         ribosomal protein L31
Swiss-Prot:RL31B_STRZT  RecName: Full=50S ribosomal protein L31 type B;

Homologs  Archaea  0/68 : Bacteria  515/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.325.1
:80 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->78 1yl34 PDBj 8e-10 43.8 %
:RPS:PDB   2->78 3bbo1 PDBj 6e-18 26.6 %
:RPS:SCOP  1->78 1vs6Z1  d.325.1.2 * 4e-22 40.0 %
:HMM:SCOP  1->79 1vs6Z1 d.325.1.2 * 1.2e-22 53.0 %
:RPS:PFM   1->78 PF01197 * Ribosomal_L31 6e-17 68.7 %
:HMM:PFM   1->79 PF01197 * Ribosomal_L31 3e-33 55.9 68/69  
:BLT:SWISS 1->80 RL31B_STRZT 2e-44 100.0 %
:PROS 48->69|PS01143|RIBOSOMAL_L31

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56565.1 GT:GENE rpmE GT:PRODUCT ribosomal protein L31 GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1164600..1164842 GB:FROM 1164600 GB:TO 1164842 GB:DIRECTION + GB:GENE rpmE GB:PRODUCT ribosomal protein L31 GB:NOTE identified by match to protein family HMM PF01197; match to protein family HMM TIGR00105 GB:PROTEIN_ID ACF56565.1 GB:DB_XREF GI:194358117 GB:GENE:GENE rpmE LENGTH 80 SQ:AASEQ MKKDIHPEYRPVVFMDTTTGYQFLSGSTKRSNETVEFEGETYPLIRVEISSDSHPFYTGRQKFTQADGRVDRFNKKYGLK GT:EXON 1|1-80:0| SW:ID RL31B_STRZT SW:DE RecName: Full=50S ribosomal protein L31 type B; SW:GN Name=rpmE2; OrderedLocusNames=SPT_0927; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->80|RL31B_STRZT|2e-44|100.0|80/80| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 48->69|PS01143|RIBOSOMAL_L31|PDOC00880| BL:PDB:NREP 1 BL:PDB:REP 1->78|1yl34|8e-10|43.8|64/73| RP:PDB:NREP 1 RP:PDB:REP 2->78|3bbo1|6e-18|26.6|64/72| RP:PFM:NREP 1 RP:PFM:REP 1->78|PF01197|6e-17|68.7|67/69|Ribosomal_L31| HM:PFM:NREP 1 HM:PFM:REP 1->79|PF01197|3e-33|55.9|68/69|Ribosomal_L31| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01197|IPR002150| GO:PFM GO:0005622|"GO:intracellular"|PF01197|IPR002150| GO:PFM GO:0005840|"GO:ribosome"|PF01197|IPR002150| GO:PFM GO:0006412|"GO:translation"|PF01197|IPR002150| RP:SCP:NREP 1 RP:SCP:REP 1->78|1vs6Z1|4e-22|40.0|65/70|d.325.1.2| HM:SCP:REP 1->79|1vs6Z1|1.2e-22|53.0|66/0|d.325.1.2|1/1|L28p-like| OP:NHOMO 536 OP:NHOMOORG 518 OP:PATTERN -------------------------------------------------------------------- ----11111111111-1----1--12-----12---11111-----11-1111111111111-21-1232-----1------1-----1111111111111111111111111111111111111-1111111111-------1---11-11---1111-1--11------111111111-11-------111211111111111111-1122221-1111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--111-11-111111-111-1111-1111-----------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111111111111111111111-11111-1111111------11-1---------------------------1---11------111111111-11----11-------1----------------------1-111------11-1-111231111111-211111211121111-11-11111111111111111111111111--------1111111-1111-------------1--11111-1-1----1--11111111111--111111-1-----11-1---------11---111111111111111111111111----------111111111-1--1---------------------------------11 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------1---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 79 STR:RPRED 98.8 SQ:SECSTR ccTTTcccccHHHHHcccccTTTcccccccccccccccccccccccccccccccccccccccccccccccccccccccT# DISOP:02AL 1-1,79-81| PSIPRED ccccccccEEEEEEEEcccccEEEEEEEEccccEEEEEcccccEEEEEEccccccEEEcEEEEEEcccHHHHHHHHHccc //