[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : rpmF
DDBJ      :rpmF         ribosomal protein L32
Swiss-Prot:RL32_STRZT   RecName: Full=50S ribosomal protein L32;

Homologs  Archaea  0/68 : Bacteria  70/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
g.41.8
:60 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->53 1vs60 PDBj 6e-07 36.5 %
:RPS:PDB   2->50 3d5b5 PDBj 3e-09 28.6 %
:RPS:SCOP  3->53 2hgj41  g.41.8.5 * 1e-11 37.3 %
:HMM:SCOP  2->56 2i2t01 g.41.8.5 * 1.7e-17 45.5 %
:RPS:PFM   2->56 PF01783 * Ribosomal_L32p 8e-07 45.5 %
:HMM:PFM   2->54 PF01783 * Ribosomal_L32p 9.9e-21 47.2 53/56  
:BLT:SWISS 1->60 RL32_STRZT 8e-31 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55933.1 GT:GENE rpmF GT:PRODUCT ribosomal protein L32 GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1959722..1959904 GB:FROM 1959722 GB:TO 1959904 GB:DIRECTION + GB:GENE rpmF GB:PRODUCT ribosomal protein L32 GB:NOTE identified by match to protein family HMM PF01783; match to protein family HMM TIGR01031 GB:PROTEIN_ID ACF55933.1 GB:DB_XREF GI:194357485 GB:GENE:GENE rpmF LENGTH 60 SQ:AASEQ MAVPARRTSKAKKNKRRTHYKVTAPSVNFDETTGDYSRSHRVSLKGYYKGRKIAKAASAE GT:EXON 1|1-60:0| SW:ID RL32_STRZT SW:DE RecName: Full=50S ribosomal protein L32; SW:GN Name=rpmF; OrderedLocusNames=SPT_2146; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->60|RL32_STRZT|8e-31|100.0|60/60| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| BL:PDB:NREP 1 BL:PDB:REP 2->53|1vs60|6e-07|36.5|52/56| RP:PDB:NREP 1 RP:PDB:REP 2->50|3d5b5|3e-09|28.6|49/52| RP:PFM:NREP 1 RP:PFM:REP 2->56|PF01783|8e-07|45.5|55/56|Ribosomal_L32p| HM:PFM:NREP 1 HM:PFM:REP 2->54|PF01783|9.9e-21|47.2|53/56|Ribosomal_L32p| GO:PFM:NREP 3 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01783|IPR002677| GO:PFM GO:0006412|"GO:translation"|PF01783|IPR002677| GO:PFM GO:0015934|"GO:large ribosomal subunit"|PF01783|IPR002677| RP:SCP:NREP 1 RP:SCP:REP 3->53|2hgj41|1e-11|37.3|51/57|g.41.8.5| HM:SCP:REP 2->56|2i2t01|1.7e-17|45.5|55/0|g.41.8.5|1/1|Zn-binding ribosomal proteins| OP:NHOMO 71 OP:NHOMOORG 70 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------111111----------------------21-1--1--11-----------1111111111111-1111111111111111111111111111111111----------------------------------------------------------------------------------------------------------------------------------------------1111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 52 STR:RPRED 86.7 SQ:SECSTR #ccccccccHHHHHHHTTTTcccccccEEccccccEEccccccTTTccccccc####### DISOP:02AL 1-19,56-61| PSIPRED cccccccccHHHHcccHHHHHcccccEEEccccccEEEEEEEccccccccEEEEcccccc //