[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : rpmG
DDBJ      :rpmG         ribosomal protein L33
Swiss-Prot:RL33_STRPS   RecName: Full=50S ribosomal protein L33;

Homologs  Archaea  0/68 : Bacteria  116/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
g.41.8
:49 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->49 3huz6 PDBj 1e-10 54.2 %
:RPS:PDB   1->49 3bbo3 PDBj 8e-09 40.8 %
:RPS:SCOP  5->49 2hgj51  g.41.8.6 * 2e-11 55.6 %
:HMM:SCOP  1->49 2gya11 g.41.8.6 * 1.9e-13 55.1 %
:RPS:PFM   2->49 PF00471 * Ribosomal_L33 2e-07 60.4 %
:HMM:PFM   2->49 PF00471 * Ribosomal_L33 1.5e-23 60.4 48/48  
:BLT:SWISS 1->49 RL33_STRPS 2e-24 100.0 %
:PROS 17->36|PS00582|RIBOSOMAL_L33

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56429.1 GT:GENE rpmG GT:PRODUCT ribosomal protein L33 GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1959920..1960069 GB:FROM 1959920 GB:TO 1960069 GB:DIRECTION + GB:GENE rpmG GB:PRODUCT ribosomal protein L33 GB:NOTE identified by match to protein family HMM PF00471; match to protein family HMM TIGR01023 GB:PROTEIN_ID ACF56429.1 GB:DB_XREF GI:194357981 GB:GENE:GENE rpmG LENGTH 49 SQ:AASEQ MRVNITLEHKESGERLYLTSKNKRNTPDRLQLKKYSPKLRKHVVFTEVK GT:EXON 1|1-49:0| SW:ID RL33_STRPS SW:DE RecName: Full=50S ribosomal protein L33; SW:GN Name=rpmG; OrderedLocusNames=SPCG_2104; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->49|RL33_STRPS|2e-24|100.0|49/49| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 17->36|PS00582|RIBOSOMAL_L33|PDOC00503| BL:PDB:NREP 1 BL:PDB:REP 2->49|3huz6|1e-10|54.2|48/48| RP:PDB:NREP 1 RP:PDB:REP 1->49|3bbo3|8e-09|40.8|49/65| RP:PFM:NREP 1 RP:PFM:REP 2->49|PF00471|2e-07|60.4|48/48|Ribosomal_L33| HM:PFM:NREP 1 HM:PFM:REP 2->49|PF00471|1.5e-23|60.4|48/48|Ribosomal_L33| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00471|IPR001705| GO:PFM GO:0005622|"GO:intracellular"|PF00471|IPR001705| GO:PFM GO:0005840|"GO:ribosome"|PF00471|IPR001705| GO:PFM GO:0006412|"GO:translation"|PF00471|IPR001705| RP:SCP:NREP 1 RP:SCP:REP 5->49|2hgj51|2e-11|55.6|45/45|g.41.8.6| HM:SCP:REP 1->49|2gya11|1.9e-13|55.1|49/0|g.41.8.6|1/1|Zn-binding ribosomal proteins| OP:NHOMO 125 OP:NHOMOORG 116 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111--221111111-11111111-2221---11111111111-11--11111111111111122113-1-11-1-----111111111111111111111--111111111111111111111111-111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 49 STR:RPRED 100.0 SQ:SECSTR cccccEEccccTTccccccEEccTTcccccccccccccccccccccccc DISOP:02AL 47-50| PSIPRED cccEEEEEEcccccccEEEEcccccccccEEEEccccccccEEEEEEcc //