[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : rpmH
DDBJ      :rpmH         ribosomal protein L34
Swiss-Prot:RL34_STRZT   RecName: Full=50S ribosomal protein L34;

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:44 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   1->26 1vs62 PDBj 4e-07 73.1 %
:HMM:PFM   1->44 PF00468 * Ribosomal_L34 9.4e-27 70.5 44/44  
:BLT:SWISS 1->26 RL34_STRZT 2e-11 100.0 %
:PROS 2->21|PS00784|RIBOSOMAL_L34
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56612.1 GT:GENE rpmH GT:PRODUCT ribosomal protein L34 GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1807230..1807364) GB:FROM 1807230 GB:TO 1807364 GB:DIRECTION - GB:GENE rpmH GB:PRODUCT ribosomal protein L34 GB:NOTE identified by match to protein family HMM PF00468; match to protein family HMM TIGR01030 GB:PROTEIN_ID ACF56612.1 GB:DB_XREF GI:194358164 GB:GENE:GENE rpmH LENGTH 44 SQ:AASEQ MKRTYQPSKLRRARKHGFRNRMSTKNGRRVLAARRRKGRKVLAA GT:EXON 1|1-44:0| SW:ID RL34_STRZT SW:DE RecName: Full=50S ribosomal protein L34; SW:GN Name=rpmH; OrderedLocusNames=SPT_1973; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->26|RL34_STRZT|2e-11|100.0|26/44| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 2->21|PS00784|RIBOSOMAL_L34|PDOC00626| SEG 27->43|grrvlaarrrkgrkvla| BL:PDB:NREP 1 BL:PDB:REP 1->26|1vs62|4e-07|73.1|26/46| HM:PFM:NREP 1 HM:PFM:REP 1->44|PF00468|9.4e-27|70.5|44/44|Ribosomal_L34| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-12,14-15,40-45| PSIPRED ccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccHHccc //