[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : rpmI
DDBJ      :rpmI         ribosomal protein L35
Swiss-Prot:RL35_STRZT   RecName: Full=50S ribosomal protein L35;

Homologs  Archaea  0/68 : Bacteria  251/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.301.1
:66 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->58 3bbo5 PDBj 5e-08 42.9 %
:RPS:PDB   3->62 3bbo5 PDBj 1e-08 41.7 %
:RPS:SCOP  2->62 2hgj71  d.301.1.1 * 6e-10 31.1 %
:HMM:SCOP  2->65 2i2t31 d.301.1.1 * 3.4e-19 46.9 %
:HMM:PFM   2->62 PF01632 * Ribosomal_L35p 9.4e-23 49.2 61/61  
:BLT:SWISS 1->66 RL35_STRZT 3e-35 100.0 %
:PROS 5->31|PS00936|RIBOSOMAL_L35

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54917.1 GT:GENE rpmI GT:PRODUCT ribosomal protein L35 GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 854059..854259 GB:FROM 854059 GB:TO 854259 GB:DIRECTION + GB:GENE rpmI GB:PRODUCT ribosomal protein L35 GB:NOTE identified by match to protein family HMM PF01632; match to protein family HMM TIGR00001 GB:PROTEIN_ID ACF54917.1 GB:DB_XREF GI:194356469 GB:GENE:GENE rpmI LENGTH 66 SQ:AASEQ MPKQKTHRASAKRFKRTGSGGLKRFRAYTSHRFHGKTKKQRRHLRKASMVHSGDYKRIKAMLTRLK GT:EXON 1|1-66:0| SW:ID RL35_STRZT SW:DE RecName: Full=50S ribosomal protein L35; SW:GN Name=rpmI; OrderedLocusNames=SPT_1243; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->66|RL35_STRZT|3e-35|100.0|66/66| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 5->31|PS00936|RIBOSOMAL_L35|PDOC00721| BL:PDB:NREP 1 BL:PDB:REP 3->58|3bbo5|5e-08|42.9|56/62| RP:PDB:NREP 1 RP:PDB:REP 3->62|3bbo5|1e-08|41.7|60/62| HM:PFM:NREP 1 HM:PFM:REP 2->62|PF01632|9.4e-23|49.2|61/61|Ribosomal_L35p| RP:SCP:NREP 1 RP:SCP:REP 2->62|2hgj71|6e-10|31.1|61/63|d.301.1.1| HM:SCP:REP 2->65|2i2t31|3.4e-19|46.9|64/0|d.301.1.1|1/1|L35p-like| OP:NHOMO 251 OP:NHOMOORG 251 OP:PATTERN -------------------------------------------------------------------- -1---1-------1----------------------------------------------------------------1--------------111-----11--1-------------------11---1---11--------------------------------------------------------1111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111--1111111111--1111111-111-111-11-111---1---1---11-----------------------------------------------------------------------------------------------------------------------------1111-11111111-11-1-111111111-------------------------1------------1-11--1--1----------111111111--------------------------------------1---1-11-------------------------1--------111-1---------------------------------11111----------------1-------1-1-------------1------11-11---------------------------------------------------------1------------------------------1-----------------1----1-1-1--11----1-1------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 64 STR:RPRED 97.0 SQ:SECSTR cccccccHHHHTTcccccccccEEEccccTTcccccccccTTcccEEEcccTHHHHTTTTTTcc## DISOP:02AL 1-10,33-48,66-67| PSIPRED cccHHHHHHHHHHHEEcccccEEEEcHHHHHHHccccHHHHHHccccEEEcHHHHHHHHHHHHccc //