[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ruvA
DDBJ      :ruvA         Holliday junction DNA helicase RuvA
Swiss-Prot:RUVA_STRZP   RecName: Full=Holliday junction ATP-dependent DNA helicase ruvA;         EC=3.6.1.-;

Homologs  Archaea  2/68 : Bacteria  820/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.5.1a.60.2b.40.4
:197 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->193 1c7yA PDBj 1e-25 39.4 %
:RPS:PDB   1->196 1c7yA PDBj 1e-27 32.1 %
:RPS:SCOP  1->62 1bvsA3  b.40.4.2 * 3e-21 27.4 %
:RPS:SCOP  36->127 2oceA1  a.60.2.6 * 5e-16 24.7 %
:HMM:SCOP  1->62 1ixrA2 b.40.4.2 * 8.7e-22 45.2 %
:HMM:SCOP  64->141 1cukA2 a.60.2.1 * 4.4e-17 41.0 %
:HMM:SCOP  149->196 1cukA1 a.5.1.1 * 2.5e-09 45.8 %
:RPS:PFM   1->61 PF01330 * RuvA_N 8e-09 45.9 %
:HMM:PFM   1->61 PF01330 * RuvA_N 1.5e-23 44.3 61/61  
:HMM:PFM   153->194 PF07499 * RuvA_C 2.3e-09 42.9 42/47  
:BLT:SWISS 1->197 RUVA_STRZP e-100 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55190.1 GT:GENE ruvA GT:PRODUCT Holliday junction DNA helicase RuvA GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 171228..171821 GB:FROM 171228 GB:TO 171821 GB:DIRECTION + GB:GENE ruvA GB:PRODUCT Holliday junction DNA helicase RuvA GB:NOTE identified by match to protein family HMM PF01330; match to protein family HMM PF07499; match to protein family HMM TIGR00084 GB:PROTEIN_ID ACF55190.1 GB:DB_XREF GI:194356742 GB:GENE:GENE ruvA LENGTH 197 SQ:AASEQ MYAYLKGIITKITAKYIVLETNGIGYILHVANPYAYSGQVNQEDQIYVHQVVREDAHLLYGFRSEDEKKLFLSLISVSGIGPVSALAIIAADDNAGLVQAIETKNITYLTKFPKIGKKTAQQMVLDLEGKVVVAGDDLPAKVAVQASAENQELEEAMEAMLALGYKATELKKIKKFFEGTTDTAENYIKSALKMLVK GT:EXON 1|1-197:0| SW:ID RUVA_STRZP SW:DE RecName: Full=Holliday junction ATP-dependent DNA helicase ruvA; EC=3.6.1.-; SW:GN Name=ruvA; OrderedLocusNames=SPP_0236; SW:KW ATP-binding; Complete proteome; DNA damage; DNA recombination;DNA repair; DNA-binding; Helicase; Hydrolase; Nucleotide-binding;SOS response. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->197|RUVA_STRZP|e-100|100.0|197/197| GO:SWS:NREP 9 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0006974|"GO:response to DNA damage stimulus"|DNA damage| GO:SWS GO:0006310|"GO:DNA recombination"|DNA recombination| GO:SWS GO:0006281|"GO:DNA repair"|DNA repair| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0004386|"GO:helicase activity"|Helicase| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0009432|"GO:SOS response"|SOS response| SEG 152->163|eleeameamlal| BL:PDB:NREP 1 BL:PDB:REP 1->193|1c7yA|1e-25|39.4|193/199| RP:PDB:NREP 1 RP:PDB:REP 1->196|1c7yA|1e-27|32.1|196/199| RP:PFM:NREP 1 RP:PFM:REP 1->61|PF01330|8e-09|45.9|61/62|RuvA_N| HM:PFM:NREP 2 HM:PFM:REP 1->61|PF01330|1.5e-23|44.3|61/61|RuvA_N| HM:PFM:REP 153->194|PF07499|2.3e-09|42.9|42/47|RuvA_C| GO:PFM:NREP 4 GO:PFM GO:0005524|"GO:ATP binding"|PF01330|IPR013849| GO:PFM GO:0006281|"GO:DNA repair"|PF01330|IPR013849| GO:PFM GO:0006310|"GO:DNA recombination"|PF01330|IPR013849| GO:PFM GO:0009378|"GO:four-way junction helicase activity"|PF01330|IPR013849| RP:SCP:NREP 2 RP:SCP:REP 1->62|1bvsA3|3e-21|27.4|62/63|b.40.4.2| RP:SCP:REP 36->127|2oceA1|5e-16|24.7|85/90|a.60.2.6| HM:SCP:REP 1->62|1ixrA2|8.7e-22|45.2|62/62|b.40.4.2|1/1|Nucleic acid-binding proteins| HM:SCP:REP 64->141|1cukA2|4.4e-17|41.0|78/78|a.60.2.1|1/1|RuvA domain 2-like| HM:SCP:REP 149->196|1cukA1|2.5e-09|45.8|48/0|a.5.1.1|1/1|DNA helicase RuvA subunit, C-terminal domain| OP:NHOMO 825 OP:NHOMOORG 823 OP:PATTERN -------------------------------------------1---1-------------------- 1111111111111111111-111111111111111111111-1-1111111-11111111111111111111111-1111111--111111111111--1-1111111111111111111111111111111111111111111111111111111111111111111111-1111111-111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111-11111111111111--1111-----11111111111111111111111111111-1111111111-1111-111111111111--11111111111111111---111---------1--11111-11111111------1-111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111-1111111111111111111111111111111111111111111111111111111111111111111111111111-11111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--11111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111-11111---1--------111---1--11------111---1---11--1111111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 197 STR:RPRED 100.0 SQ:SECSTR cccEEEEEEEEEETTEEEEEETTEEEEEEccHHHHTTccTTcEEEEEEEEccccccccEEEEccHHHHHHHHHHHHcTTccHHHHHHHHHHccHHHHHHHHHTTcHHHHHTcTTccHHHHHHHHHHHTccccTTcTTcTTHHHHHHccccHHHHHHHHHHHHTTccHHHHHHHHHHHccTTccHHHHHHHHHHHHcc DISOP:02AL 136-152| PSIPRED ccEEEEEEEEEEcccEEEEEEccEEEEEEccccHHHccccccEEEEEEEEEEEccHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHccHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHHHHHcc //