[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : scpB
DDBJ      :scpB         segregation and condensation protein B
Swiss-Prot:SCPB_STRZT   RecName: Full=Segregation and condensation protein B;

Homologs  Archaea  4/68 : Bacteria  561/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:189 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->153 1t6sA PDBj 1e-18 31.7 %
:RPS:SCOP  4->78 1t6sA1  a.4.5.60 * 2e-10 26.0 %
:RPS:SCOP  87->157 1t6sA2  a.4.5.60 * 5e-08 40.8 %
:HMM:SCOP  1->80 1t6sA1 a.4.5.60 * 3.7e-14 42.3 %
:HMM:SCOP  81->157 1t6sA2 a.4.5.60 * 2e-24 55.8 %
:RPS:PFM   7->164 PF04079 * DUF387 6e-32 50.0 %
:HMM:PFM   5->165 PF04079 * DUF387 1e-55 51.3 158/159  
:BLT:SWISS 1->189 SCPB_STRZT e-102 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56657.1 GT:GENE scpB GT:PRODUCT segregation and condensation protein B GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1694358..1694927) GB:FROM 1694358 GB:TO 1694927 GB:DIRECTION - GB:GENE scpB GB:PRODUCT segregation and condensation protein B GB:NOTE identified by match to protein family HMM PF04079; match to protein family HMM TIGR00281 GB:PROTEIN_ID ACF56657.1 GB:DB_XREF GI:194358209 GB:GENE:GENE scpB LENGTH 189 SQ:AASEQ MSTLAKIEALLFVAGEDGIRVRQLAELLSLPPTGIQQSLGKLAQKYEKDPDSSLALIETSGAYRLVTKPQFAEILKEYSKAPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLGRPNLYVTTDYFLDYMGINHLEELPVIDELEIQAQESQLFGERIEEDENQ GT:EXON 1|1-189:0| SW:ID SCPB_STRZT SW:DE RecName: Full=Segregation and condensation protein B; SW:GN Name=scpB; OrderedLocusNames=SPT_1792; SW:KW Cell cycle; Cell division; Chromosome partition; Complete proteome;Cytoplasm. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->189|SCPB_STRZT|e-102|100.0|189/189| GO:SWS:NREP 4 GO:SWS GO:0007049|"GO:cell cycle"|Cell cycle| GO:SWS GO:0051301|"GO:cell division"|Cell division| GO:SWS GO:0007059|"GO:chromosome segregation"|Chromosome partition| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| BL:PDB:NREP 1 BL:PDB:REP 14->153|1t6sA|1e-18|31.7|139/162| RP:PFM:NREP 1 RP:PFM:REP 7->164|PF04079|6e-32|50.0|156/160|DUF387| HM:PFM:NREP 1 HM:PFM:REP 5->165|PF04079|1e-55|51.3|158/159|DUF387| RP:SCP:NREP 2 RP:SCP:REP 4->78|1t6sA1|2e-10|26.0|73/85|a.4.5.60| RP:SCP:REP 87->157|1t6sA2|5e-08|40.8|71/77|a.4.5.60| HM:SCP:REP 1->80|1t6sA1|3.7e-14|42.3|78/0|a.4.5.60|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 81->157|1t6sA2|2e-24|55.8|77/0|a.4.5.60|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 571 OP:NHOMOORG 566 OP:PATTERN -----------------------1-------------------------1----------------11 111-111111111111111-11111111111111111111111111--11111111-1--111-1111111----11111111----------------------11-1---------------111111111-1111111---11--------------------------------------11111111111111111111111111111111111111111111111111111111-111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11-1-111111111-111111111-----11-11---1----11111111112------1--12--111-11-1111-1211111111111111111111111111111-----------------------------11111-111111111111111111111111111111111111111111111111111111111111-111111111111-1-----------111111111111111---------------------------1111-111-111-1111111111111111111--11111--------------------------------------------------------------------------------------------11111111111111----------------11111111111111111111111111111------------------------11111111111111---1111111--------11-----1-1111111111111111111-1-1-1-111-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 151 STR:RPRED 79.9 SQ:SECSTR ######HHHHHHHHccccccHHHHHHHTTccHHHHHHHHHHHHHHHHHHTTccEEEEEETTEEEEEEcGGGHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccEEHHHHHHHHTcccccHHHHHHHTTcEEEEEEcccTTccEEEEEcHHHHHHHcc################################ DISOP:02AL 1-2,176-190| PSIPRED ccHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHHHHccccccEEEEEEccEEEEEEcHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHcccEEEccccccccccEEEEEcHHHHHHcccccHHHcccccHHHHccccHHHHHHHHHHcccc //