[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : sdhA
DDBJ      :sdhA         L-serine dehydratase, iron-sulfur-dependent, alpha subunit
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  586/915 : Eukaryota  28/199 : Viruses  0/175   --->[See Alignment]
e.44.1
:290 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  21->278 1szqA  e.44.1.1 * 3e-32 9.6 %
:RPS:PFM   19->275 PF03313 * SDH_alpha 2e-36 42.7 %
:HMM:PFM   19->277 PF03313 * SDH_alpha 6.3e-83 45.1 255/283  
:BLT:SWISS 1->289 SDHA_BACSU 7e-83 54.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56506.1 GT:GENE sdhA GT:PRODUCT L-serine dehydratase, iron-sulfur-dependent, alpha subunit GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(104579..105451) GB:FROM 104579 GB:TO 105451 GB:DIRECTION - GB:GENE sdhA GB:PRODUCT L-serine dehydratase, iron-sulfur-dependent, alpha subunit GB:NOTE identified by match to protein family HMM PF03313; match to protein family HMM TIGR00718 GB:PROTEIN_ID ACF56506.1 GB:DB_XREF GI:194358058 GB:GENE:GENE sdhA LENGTH 290 SQ:AASEQ MFYSIKELVEQADLDFQGNVAELMITTEFELTGREREEVFLLMERNLEVMKASVQLGLNENKSRSGLTGGDAAKLDHYIENGKTLSDYTILSAARNAIAVNEHNAKMGLVCATPTAGSAGCLPSVLTAAIEKLDLSHEQQLDFLFAAGAFGLVIANNASISGAEGGCQAEVGSASAMSAAALTLAAGGTPYQASQAIAFVIKNMLGLICDPVAGLVEVPCVKRNAMGASFAFIAADMALAGIESKIPVDEVIDAMYQVGASMPTAFRETAEGGLATTPTGRRLQKEIFGE GT:EXON 1|1-290:0| BL:SWS:NREP 1 BL:SWS:REP 1->289|SDHA_BACSU|7e-83|54.9|288/300| SEG 172->189|gsasamsaaaltlaaggt| RP:PFM:NREP 1 RP:PFM:REP 19->275|PF03313|2e-36|42.7|253/275|SDH_alpha| HM:PFM:NREP 1 HM:PFM:REP 19->277|PF03313|6.3e-83|45.1|255/283|SDH_alpha| RP:SCP:NREP 1 RP:SCP:REP 21->278|1szqA|3e-32|9.6|239/473|e.44.1.1| OP:NHOMO 862 OP:NHOMOORG 615 OP:PATTERN ----------------------------------------------------------------1--- 111-112-11111----11-111111111111-----1341---1-11-11-333111--11-1112111-11111111111------1111-111---1111111-1-1--------------1-----------------------------------------1----------------11111--1-1122222111121221111111112211111111111111-1111111111111112111121--11---1111111111----11111111111--1111111111111111111111111111111111-11121111111111-111122221-11-1---11-1--1121111--1-1-22111-1111-1------------111-111111-11-1121121--111111111111211111111111111--------11111-----------------------------------211111112222222111122222222122331211--11311111--11-1-11----211111-1111--------1112112111--------------11-------1111111-1111111-------2211--111112111112211112122122--1----------42222213333332333-3333333333333333332222221124433444444444434233333331-211111111111---1111111111--111111-111111----111111--1111-22223333133341111111111111-222222222322231111111111-------1--------------1---------------------------1-111-1-----1 -----------2111-1-------------------------------11111111---------------------------------1111111----111222--2------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,290-291| PSIPRED ccccHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccEEEcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccccEEEccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHcHHHHHHHHHHHcc //