[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : sdhB
DDBJ      :sdhB         L-serine dehydratase, iron-sulfur-dependent, beta subunit
Swiss-Prot:             

Homologs  Archaea  12/68 : Bacteria  210/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.18d.81.2
:223 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->93 2iqqA PDBj 9e-05 42.3 %
:RPS:PDB   8->219 3dc2A PDBj 3e-18 14.7 %
:RPS:SCOP  22->118 2iafA1  d.81.2.1 * 3e-18 27.8 %
:RPS:SCOP  144->219 1psdA3  d.58.18.1 * 1e-12 21.1 %
:HMM:SCOP  22->142 2iafA1 d.81.2.1 * 1.2e-26 35.9 %
:HMM:SCOP  140->223 1psdA3 d.58.18.1 * 1.2e-18 36.9 %
:RPS:PFM   8->92 PF03315 * SDH_beta 2e-12 45.2 %
:RPS:PFM   159->213 PF01842 * ACT 7e-04 32.7 %
:HMM:PFM   8->140 PF03315 * SDH_beta 2e-34 33.6 131/158  
:HMM:PFM   153->214 PF01842 * ACT 3.2e-13 25.8 62/66  
:BLT:SWISS 4->219 SDHB_BACSU 2e-49 42.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55201.1 GT:GENE sdhB GT:PRODUCT L-serine dehydratase, iron-sulfur-dependent, beta subunit GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(105460..106131) GB:FROM 105460 GB:TO 106131 GB:DIRECTION - GB:GENE sdhB GB:PRODUCT L-serine dehydratase, iron-sulfur-dependent, beta subunit GB:NOTE identified by match to protein family HMM PF01842; match to protein family HMM PF03315; match to protein family HMM TIGR00719 GB:PROTEIN_ID ACF55201.1 GB:DB_XREF GI:194356753 GB:GENE:GENE sdhB LENGTH 223 SQ:AASEQ MKSLRFQSVFDIIGPVMIGPSSSHTAGAVRIGKIVSSIFDDTPTEVEFQLFNSFAKTYRGHGTDLALVAGILGMDTDDPEIPNSLEIAHKRGIKIVWTIQKDSNAPHPNTTKITVKNAHKTISVTGISIGGGNIQVTELNGFAVSLNMNTPTIIIVHQDIPGMIALVTEALSRYGINIAQMNVTREKAGEKAIMIIEVDSRNCDEAIEEIRKIPHLHNVNFFK GT:EXON 1|1-223:0| BL:SWS:NREP 1 BL:SWS:REP 4->219|SDHB_BACSU|2e-49|42.8|215/220| SEG 121->134|tisvtgisigggni| BL:PDB:NREP 1 BL:PDB:REP 22->93|2iqqA|9e-05|42.3|71/141| RP:PDB:NREP 1 RP:PDB:REP 8->219|3dc2A|3e-18|14.7|211/526| RP:PFM:NREP 2 RP:PFM:REP 8->92|PF03315|2e-12|45.2|84/156|SDH_beta| RP:PFM:REP 159->213|PF01842|7e-04|32.7|55/65|ACT| HM:PFM:NREP 2 HM:PFM:REP 8->140|PF03315|2e-34|33.6|131/158|SDH_beta| HM:PFM:REP 153->214|PF01842|3.2e-13|25.8|62/66|ACT| GO:PFM:NREP 5 GO:PFM GO:0003941|"GO:L-serine ammonia-lyase activity"|PF03315|IPR005131| GO:PFM GO:0006094|"GO:gluconeogenesis"|PF03315|IPR005131| GO:PFM GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|PF03315|IPR005131| GO:PFM GO:0008152|"GO:metabolic process"|PF01842|IPR002912| GO:PFM GO:0016597|"GO:amino acid binding"|PF01842|IPR002912| RP:SCP:NREP 2 RP:SCP:REP 22->118|2iafA1|3e-18|27.8|97/140|d.81.2.1| RP:SCP:REP 144->219|1psdA3|1e-12|21.1|76/84|d.58.18.1| HM:SCP:REP 22->142|2iafA1|1.2e-26|35.9|117/0|d.81.2.1|1/1|Serine metabolism enzymes domain| HM:SCP:REP 140->223|1psdA3|1.2e-18|36.9|84/0|d.58.18.1|1/1|ACT-like| OP:NHOMO 268 OP:NHOMOORG 222 OP:PATTERN ----------------------------------11--1111111-11----------------1--- ------------------------------------------------------------------------------1111-11--------------------------------------------------------------------1-----------------------------111111--1222222211112122111222121222221211111111111222222222222223221221--11---1111111111----11111111111--1111111111111111111111111111111111111111111111111--11222211-11-1---11-1-121211111---1-1----------------------11111111111----------11-111---11--11--1-----------1-------------1--------------------------------1111-------------------------------------------------------------------------1--------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1---------------------------1-111-1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 212 STR:RPRED 95.1 SQ:SECSTR #######TccccccTTccTTTTHHHHHHHHHHHHHHHTccccccEEEEEEEEGGGGcccHHHHHHHHHHHTGGGcccccccccHHHHHHHHTccEEEEEEEcccccccEEEEEEETTccEEEEEEEEETTTTEEEEEEETTEEEEEEcccEEEEEEEcccTTHHHHHHHHHHHTTccEEEEEEEcccccccEEEEEEEcccccHHHHHHHHHHHTccEE#### DISOP:02AL 1-2| PSIPRED cccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccEEEEEEEEEEHHHcccccHHHHHHHHHHHcccccccccccHHHHHHHccEEEEEEEccccccccccEEEEEEEEccEEEEEEEEEEccccEEEEEEccccccccccccEEEEcccccccHHHHHHHHHHHHcccHHHHHHHHHHcccEEEEEEEEcccccHHHHHHHHcccccEEEEEEc //