[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : speE
DDBJ      :speE         spermidine synthase
Swiss-Prot:SPEE_STRR6   RecName: Full=Spermidine synthase;         EC=2.5.1.16;AltName: Full=Putrescine aminopropyltransferase;         Short=PAPT;AltName: Full=SPDSY;

Homologs  Archaea  44/68 : Bacteria  372/915 : Eukaryota  182/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:286 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->276 1inlB PDBj 3e-59 39.8 %
:RPS:PDB   23->241 3c6kC PDBj 9e-46 24.9 %
:RPS:SCOP  2->279 1inlA  c.66.1.17 * 2e-86 39.0 %
:HMM:SCOP  4->282 1inlA_ c.66.1.17 * 1.8e-76 33.2 %
:RPS:PFM   23->236 PF01564 * Spermine_synth 9e-57 47.4 %
:HMM:PFM   4->239 PF01564 * Spermine_synth 2.1e-66 38.9 234/246  
:BLT:SWISS 1->286 SPEE_STRR6 e-172 99.3 %
:PROS 256->267|PS00962|RIBOSOMAL_S2_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54984.1 GT:GENE speE GT:PRODUCT spermidine synthase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 821613..822473 GB:FROM 821613 GB:TO 822473 GB:DIRECTION + GB:GENE speE GB:PRODUCT spermidine synthase GB:NOTE identified by match to protein family HMM PF01564; match to protein family HMM TIGR00417 GB:PROTEIN_ID ACF54984.1 GB:DB_XREF GI:194356536 GB:GENE:GENE speE LENGTH 286 SQ:AASEQ MDLWFSEVHTPDVKLSLRTAKQLYAGKSEWQDIEVLDTPAFGKILILNGHVLFSDADDFVYNEMTVHVPMAVHPNPKKVLVIGGGDGGVAQVLTLYPELEQIDIVEPDEMLVEVCREYFPDFAAGLDDPRVTIYYQNGLRFLRNCEYDYDIIINDATDPFGHTEGLFTKEXYGNSYRALKEDGIMIYQHGSPFFDEDESACRSMHRKVNQAFPISRVYQAHIPTSPAGYWLFGFASKKYHPVKDFDKEGWKKRQLFTEYYTANLHVGAFMLPKYVEDILEEEEGKK GT:EXON 1|1-286:0| SW:ID SPEE_STRR6 SW:DE RecName: Full=Spermidine synthase; EC=2.5.1.16;AltName: Full=Putrescine aminopropyltransferase; Short=PAPT;AltName: Full=SPDSY; SW:GN Name=speE; OrderedLocusNames=spr0819; SW:KW Complete proteome; Polyamine biosynthesis; Spermidine biosynthesis;Transferase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->286|SPEE_STRR6|e-172|99.3|286/286| GO:SWS:NREP 3 GO:SWS GO:0006596|"GO:polyamine biosynthetic process"|Polyamine biosynthesis| GO:SWS GO:0008295|"GO:spermidine biosynthetic process"|Spermidine biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 256->267|PS00962|RIBOSOMAL_S2_1|PDOC00744| BL:PDB:NREP 1 BL:PDB:REP 3->276|1inlB|3e-59|39.8|269/291| RP:PDB:NREP 1 RP:PDB:REP 23->241|3c6kC|9e-46|24.9|213/346| RP:PFM:NREP 1 RP:PFM:REP 23->236|PF01564|9e-57|47.4|209/226|Spermine_synth| HM:PFM:NREP 1 HM:PFM:REP 4->239|PF01564|2.1e-66|38.9|234/246|Spermine_synth| GO:PFM:NREP 1 GO:PFM GO:0003824|"GO:catalytic activity"|PF01564|IPR001045| RP:SCP:NREP 1 RP:SCP:REP 2->279|1inlA|2e-86|39.0|267/285|c.66.1.17| HM:SCP:REP 4->282|1inlA_|1.8e-76|33.2|277/295|c.66.1.17|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 789 OP:NHOMOORG 598 OP:PATTERN 111112111111111122111111-----------11111111----1------11111111111--- -12-----111------11-1-----11111--1111111---1----------------1-----1-21-------------21111---------------1-1----------------------------2----------12-1-11111111111211------2111111111111---1122-121222222121222222111111221222-111------111-------------------------------------------------------11111111111----------------------111111-------1-1-111-111111--21111221212--2111211-1-21----------------1---------------------------1-------------------1------1-1111111111111--1----------------------------------------22222211111111-11111121111-2------11222---1-----------------11-11-112------1----------1----1212211-----------11--------1-1-11--1-111--2-2---------------------11111--1111111-111111111111-11111111111111111111111111-1111111111111111111111111-111111111111--11---------1111--------------------------1-2222--1------1111-1111-1111--------------11111122221111--1-112221------------------------------------1111111111--- 11--111-3-1-1121111111111111111111111111111111111111111-11111122212222222222221222222211-21111211111111111-122112111-1-3-11111-21171-111-11111111-11--11122111222221211211312212222N2221253691743732122 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 282 STR:RPRED 98.6 SQ:SECSTR cccEEEEccccTTccEEEEEEEEEEEEccccEEEEEEETTTEEEEEETTEEEEETTcHHHHHHHHTTTTccccTcTcEEEEEEcTTcHHHHHHHTTccccEEEEEEccHHHHHHHHHHcccccGccccccEEEEEccHHHHHHHHHHTEEEEEEEccccccccHHHHHHHHHHHHHHTEEEEEEEEEEEEETTcHHHHHHHHHHHTcccccEEEEEEEEEEcGGGcTcEEEEEEEEEcccccTTcccccGGGTTGGcccccHHHHHHHTcccGGGGGGTcGT#### DISOP:02AL 282-287| PSIPRED cccEEEEEEccccEEEEEEEEEEEEEEccccEEEEEEEccccEEEEEccEEEEcccccHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHHccccccccEEEEEccHHHHHHHccccccEEEEEccccccccHHHccHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHHHHHHHccccEEEEEEccccccccEEEEEEEccccccccccHHHHHHcccccccccHHHHHHHHHccHHHHHHHHHHHccc //