[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : sulC
DDBJ      :sulC         GTP cyclohydrolase I
Swiss-Prot:GCH1_STRPN   RecName: Full=GTP cyclohydrolase 1;         EC=3.5.4.16;AltName: Full=GTP cyclohydrolase I;         Short=GTP-CH-I;

Homologs  Archaea  22/68 : Bacteria  714/915 : Eukaryota  185/199 : Viruses  2/175   --->[See Alignment]
d.96.1
:184 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->182 1is7A PDBj 3e-39 43.4 %
:RPS:PDB   2->183 1a9cA PDBj 1e-50 35.2 %
:RPS:SCOP  1->182 1a8rA  d.96.1.1 * 4e-61 36.3 %
:HMM:SCOP  1->184 1fb1A_ d.96.1.1 * 9.9e-70 51.1 %
:RPS:PFM   81->166 PF01227 * GTP_cyclohydroI 3e-27 59.3 %
:HMM:PFM   81->166 PF01227 * GTP_cyclohydroI 9.1e-37 61.6 86/86  
:BLT:SWISS 1->184 GCH1_STRPN e-103 100.0 %
:PROS 62->78|PS00859|GTP_CYCLOHYDROL_1_1
:PROS 110->120|PS00860|GTP_CYCLOHYDROL_1_2

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55748.1 GT:GENE sulC GT:PRODUCT GTP cyclohydrolase I GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 267458..268012 GB:FROM 267458 GB:TO 268012 GB:DIRECTION + GB:GENE sulC GB:PRODUCT GTP cyclohydrolase I GB:NOTE identified by match to protein family HMM PF01227; match to protein family HMM TIGR00063 GB:PROTEIN_ID ACF55748.1 GB:DB_XREF GI:194357300 GB:GENE:GENE sulC LENGTH 184 SQ:AASEQ MDTQKIEAAVKMIIEAVGEDANREGLQETPARVARMYQEIFSGLGQTAEEHLSKSFEIIDDNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIPDGRVAGLSKLARTVEVYSKKPQIQERLNIEVADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGLFETDKDLRDQAYRLMGL GT:EXON 1|1-184:0| SW:ID GCH1_STRPN SW:DE RecName: Full=GTP cyclohydrolase 1; EC=3.5.4.16;AltName: Full=GTP cyclohydrolase I; Short=GTP-CH-I; SW:GN Name=folE; Synonyms=sulC; OrderedLocusNames=SP_0291; SW:KW Complete proteome; GTP-binding; Hydrolase; Metal-binding;Nucleotide-binding; One-carbon metabolism; Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->184|GCH1_STRPN|e-103|100.0|184/184| GO:SWS:NREP 5 GO:SWS GO:0005525|"GO:GTP binding"|GTP-binding| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006730|"GO:one-carbon metabolic process"|One-carbon metabolism| PROS 62->78|PS00859|GTP_CYCLOHYDROL_1_1|PDOC00672| PROS 110->120|PS00860|GTP_CYCLOHYDROL_1_2|PDOC00672| BL:PDB:NREP 1 BL:PDB:REP 1->182|1is7A|3e-39|43.4|182/194| RP:PDB:NREP 1 RP:PDB:REP 2->183|1a9cA|1e-50|35.2|182/221| RP:PFM:NREP 1 RP:PFM:REP 81->166|PF01227|3e-27|59.3|86/86|GTP_cyclohydroI| HM:PFM:NREP 1 HM:PFM:REP 81->166|PF01227|9.1e-37|61.6|86/86|GTP_cyclohydroI| RP:SCP:NREP 1 RP:SCP:REP 1->182|1a8rA|4e-61|36.3|182/221|d.96.1.1| HM:SCP:REP 1->184|1fb1A_|9.9e-70|51.1|184/196|d.96.1.1|1/1|Tetrahydrobiopterin biosynthesis enzymes-like| OP:NHOMO 1095 OP:NHOMOORG 923 OP:PATTERN ---1-11111111111-111111-1--1--------------------------------------11 1111211111111111111-1111211111121111213322211111111111111111113111211111---111111211111111111111---11122413111--------------1111111111111111111111322122211111111112111221211211111111111111--12111111111111111111111111111111---11111111--------------------1--1--11-1-1111--1--1--111111111111111111111111111111111111111111-1111-1-111111111-1-111111111-1-111-11221111--11111--11111211311111121221121111211111111111111111311111111111112111111111----------11111111111112121121111111--1111111111111----1131111----1111212323322113333-11211111-1--1111111111111112---2----------111-1-----------------------111111--1111111111111111111111111--1111113-11-11111121111111121111--11-11-----11111111111111111-1111111111111111111111111211111111111111111111111111111111111111111111111111111-11111111111111-11111111111111122222322221222222111111111-1111111111121111111111111111----111111-----------------------------------------------1- 11--11--1---111221112112122111111111211111111-2111121211221111111111111111111-1111111111-11121111111111111-1113143411111111111131494-312111111111111111111-11222211111-321511111111F1111121221211121111 -------------------1-----------------------------------------------------------------------------------------------------1----------------------------------------------------- STR:NPRED 183 STR:RPRED 99.5 SQ:SECSTR cHHHHHHHHHHHHHHHTTccTTcTTGGGHHHHHHHHHHHTTGGGcGGGcccccEEEcTTccccEEEEEEEEEEEETTTccEEEEEEEEEEccccEEEcHHHHHHHHHHHHccEEcHHHHHHHHHHHHHHHHTcccEEEEEEEEEHHHHccTTccccccEEEEEEcTHHHHcHHHHHHHHHHcc# DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccHHHHcccccccccccEEEEccEEEEEEcccccccEEEEEEEEEEcccEEEEHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccEEEEEEEEEEEEEEccEEccccEEEEEEEEHHHHccHHHHHHHHHHHcc //