[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : tktA
DDBJ      :tktA         transketolase
Swiss-Prot:TKT_STRPN    RecName: Full=Probable transketolase;         Short=TK;         EC=2.2.1.1;

Homologs  Archaea  36/68 : Bacteria  867/915 : Eukaryota  191/199 : Viruses  0/175   --->[See Alignment]
c.36.1c.48.1
:658 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->657 3hylA PDBj 0.0 58.4 %
:RPS:PDB   4->657 2e6kA PDBj e-123 49.8 %
:RPS:SCOP  4->332 1ay0A1  c.36.1.10 * e-112 49.5 %
:RPS:SCOP  350->526 1dtwB1  c.36.1.7 * 1e-35 12.6 %
:RPS:SCOP  524->657 1ay0A3  c.48.1.1 * 9e-24 42.6 %
:HMM:SCOP  6->334 1r9jA2 c.36.1.10 * 1.3e-107 37.1 %
:HMM:SCOP  329->524 1qgdA1 c.36.1.6 * 1.2e-63 44.3 %
:HMM:SCOP  524->657 1itzA3 c.48.1.1 * 1.1e-43 48.5 %
:RPS:PFM   4->271 PF00456 * Transketolase_N 9e-95 61.7 %
:RPS:PFM   352->495 PF02779 * Transket_pyr 2e-11 39.6 %
:RPS:PFM   533->646 PF02780 * Transketolase_C 2e-08 36.7 %
:HMM:PFM   3->334 PF00456 * Transketolase_N 1.4e-155 59.1 330/333  
:HMM:PFM   352->521 PF02779 * Transket_pyr 4.7e-46 34.3 166/178  
:HMM:PFM   542->649 PF02780 * Transketolase_C 4e-15 27.4 106/124  
:BLT:SWISS 1->658 TKT_STRPN 0.0 99.5 %
:PROS 10->30|PS00801|TRANSKETOLASE_1
:PROS 464->480|PS00802|TRANSKETOLASE_2

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56588.1 GT:GENE tktA GT:PRODUCT transketolase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1844975..1846951) GB:FROM 1844975 GB:TO 1846951 GB:DIRECTION - GB:GENE tktA GB:PRODUCT transketolase GB:NOTE identified by match to protein family HMM PF00456; match to protein family HMM PF02779; match to protein family HMM PF02780; match to protein family HMM TIGR00232 GB:PROTEIN_ID ACF56588.1 GB:DB_XREF GI:194358140 GB:GENE:GENE tktA LENGTH 658 SQ:AASEQ MSNLSVNAIRFLGIDAINKANSGHPGVVMGAAPMAYSLFTKQLHINPAQPNWINRDRFILSAGHGSMLLYALLHLSGFEDVSMNEIKSFRQWGSKTPGHPEFGHTAGIDATTGPLGQGISTATGFAQAERFLAAKYNREGYNIFDHYTYVICGDGDLMEGVSSEAASYAGLQKLDKLVVLYDSNDINLDGETKDSFTESVRDRYNAYGWHTALVENGTDLEAIHAAIETAKASGKPSLIEVKTVIGYGSPNKQGTNAVHGAPLGADETASTRQALGWDYEPFEIPEQVYADFKEHVADRGASAYQAWTKLVADYKEVHPELAAEVEAIIDGRDPVEVTPADFPALENGFSQATRNSSQDALNVVAAKLPTFLGGSADLAHSNMTYIKTDGLQDDANRLNRNIQFGVREFAMGTILNGMALHGGLRVYGGTFFVFSDYVKAAVRLSALQGLPVTYVFTHDSIAVGEDGPTHEPVEHLAGLRAMPNLNVFRPADARETQAAWYLAVTSEKTPTALVLTRQNLTVEDGTDFDKVAKGAYVVYENAADFDTILIATGSEVNLAVSAAKELASQGEKIRVVSMPSTDVFDKQDAAYKEEILPNAVRRRVAVEMGASQNWYKYVGLDGAVXGIDTFGASAPAPKVLAEYGFTVENLVKVVRNLK GT:EXON 1|1-658:0| SW:ID TKT_STRPN SW:DE RecName: Full=Probable transketolase; Short=TK; EC=2.2.1.1; SW:GN Name=tkt; Synonyms=recP; OrderedLocusNames=SP_2030; SW:KW Calcium; Complete proteome; DNA recombination; Metal-binding;Thiamine pyrophosphate; Transferase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->658|TKT_STRPN|0.0|99.5|658/658| GO:SWS:NREP 3 GO:SWS GO:0006310|"GO:DNA recombination"|DNA recombination| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 10->30|PS00801|TRANSKETOLASE_1|PDOC00635| PROS 464->480|PS00802|TRANSKETOLASE_2|PDOC00635| BL:PDB:NREP 1 BL:PDB:REP 1->657|3hylA|0.0|58.4|634/642| RP:PDB:NREP 1 RP:PDB:REP 4->657|2e6kA|e-123|49.8|626/632| RP:PFM:NREP 3 RP:PFM:REP 4->271|PF00456|9e-95|61.7|266/275|Transketolase_N| RP:PFM:REP 352->495|PF02779|2e-11|39.6|139/172|Transket_pyr| RP:PFM:REP 533->646|PF02780|2e-08|36.7|109/122|Transketolase_C| HM:PFM:NREP 3 HM:PFM:REP 3->334|PF00456|1.4e-155|59.1|330/333|Transketolase_N| HM:PFM:REP 352->521|PF02779|4.7e-46|34.3|166/178|Transket_pyr| HM:PFM:REP 542->649|PF02780|4e-15|27.4|106/124|Transketolase_C| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF02780|IPR005476| GO:PFM GO:0008152|"GO:metabolic process"|PF02780|IPR005476| RP:SCP:NREP 3 RP:SCP:REP 4->332|1ay0A1|e-112|49.5|325/335|c.36.1.10| RP:SCP:REP 350->526|1dtwB1|1e-35|12.6|174/188|c.36.1.7| RP:SCP:REP 524->657|1ay0A3|9e-24|42.6|129/146|c.48.1.1| HM:SCP:REP 6->334|1r9jA2|1.3e-107|37.1|326/0|c.36.1.10|1/1|Thiamin diphosphate-binding fold (THDP-binding)| HM:SCP:REP 329->524|1qgdA1|1.2e-63|44.3|192/195|c.36.1.6|1/1|Thiamin diphosphate-binding fold (THDP-binding)| HM:SCP:REP 524->657|1itzA3|1.1e-43|48.5|134/136|c.48.1.1|1/1|TK C-terminal domain-like| OP:NHOMO 1900 OP:NHOMOORG 1094 OP:PATTERN 11-1--1111111111-121221------2-----22222222------------1--11-222--22 1241311111111111111-1111131111111111214221121121111142311111112123343311111111211212113211121111--12211422231411111111111111123212323223111111121122222221111111211111222112121121111111111112-11222222122122222232331122122211113444331211111111111111111111-11----1--123--1--1-1111112321122-11322223323231111111121111111111222331227222222242514222222113112132211222232323112113141111111111214451122322411111111112-22323522221122212433324315211112223311122222222232112221111111111---------------1111211111211115441422222222422222221132232111114211123313111211111111111111121121313-111114111135433244111311211111211111111111111112111122117111111111111111111111111111111221111111132322422223233322-2222233222232222224565321114333333333333333212122221122122222222211111111111112112111122111111111222232111113111111133111321231111111111122222222222322111111111111111122222233--------111----1-11121211111121111111211112121111 11--211-311112122224241333511111111111112111112122235322211111113111111223222-2211111111-2222232545211122211222453221212223233242BP3-43312224225-2232231141112211-12211411711222111J1111142552222221111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 657 STR:RPRED 99.8 SQ:SECSTR HHHHHHHHHHHHHHHHHHHHTccccHHHHHHHHHHHHHHHHTTcccTTcTTcTTccEEEEccGGGHHHHHHHHHTTTTccccHHHHTTTTcTTcccccccccTTcTTcccccccTTHHHHHHHHHHHHHHHHHHHHccTTcccccccEEEEEcHHHHHcHHHHHHHHHHHHTTcTTEEEEEEEccEETTEEGGGTccccHHHHHHHTTcEEEEEccTTcHHHHHHHHHHHHHccccEEEEEEccTTTTcTTTTTcGGGTccccHHHHHHHHHHHHTccccTTcccHHHHHHcHHHTHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHTTccccccccccccccccccccccHHHHHHHHHHHHGGGcTTEEEEEcccHHHHTcccTTccccTTGcTTccEEEccccHHHHHHHHHHHHHHcccEEEEEEEGGGGGGGHHHHHHHHHHTcccEEEEEcccGGGcTTcTTTccccHHHHHHHTTTcEEEccccHHHHHHHHHHHHHcccccEEEEccccccccccHHHHGGGGGccEEEEcccccccEEEEEcTTHHHHHHHHHHHHHHTTccEEEEEcccHHHHHTccHHHHHHHccTTTccEEEEcccccTTGGGTcHHHcEEEccccccccccTTHHHHHTTccHHHHHHHHHTT# DISOP:02AL 1-2| PSIPRED cHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccccccccEEEEEcccccHHHHHHHHHcccccccHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEccccccHHHHHHHHHHHHHcccccEEEEEEcccEEccccHHHcccHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHcccEEEEEEccccccccccccccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEHHHccccccEEccccccccccccccEEEccccHHHHHHHHHHHHHHcccccEEEEHHHHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccHHHHHHHHcccccEEEEcccHHHHHHHHHHHHHcccccEEEEEEcccccccccccccccccccEEEEEcccccEEEEEEccHHHHHHHHHHHHHHHccccEEEEEcccccccccccHHHHHHHcccccccEEEEEccHHHHHHHHccccccccccccccccccHHHHHHHccccHHHHHHHHHHcc //