[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : trxB
DDBJ      :trxB         thioredoxin reductase
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  898/915 : Eukaryota  129/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:303 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->291 2q7vB PDBj 2e-64 43.1 %
:RPS:PDB   3->302 2a87B PDBj 1e-55 46.0 %
:RPS:SCOP  2->113 2gqfA1  c.3.1.8 * 1e-10 23.2 %
:RPS:SCOP  84->293 1mo9A1  c.3.1.5 * 9e-26 12.0 %
:HMM:SCOP  1->301 1f8rA1 c.3.1.2 * 4.3e-58 30.6 %
:RPS:PFM   3->273 PF07992 * Pyr_redox_2 3e-24 35.0 %
:HMM:PFM   3->274 PF07992 * Pyr_redox_2 6.7e-45 36.3 193/202  
:BLT:SWISS 1->299 TRXB_LISMO 3e-96 55.9 %
:PROS 130->150|PS00573|PYRIDINE_REDOX_2

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56820.1 GT:GENE trxB GT:PRODUCT thioredoxin reductase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1343390..1344301) GB:FROM 1343390 GB:TO 1344301 GB:DIRECTION - GB:GENE trxB GB:PRODUCT thioredoxin reductase GB:NOTE identified by match to protein family HMM PF00070; match to protein family HMM PF01134; match to protein family HMM PF01266; match to protein family HMM PF03486; match to protein family HMM PF07992; match to protein family HMM TIGR01292 GB:PROTEIN_ID ACF56820.1 GB:DB_XREF GI:194358372 GB:GENE:GENE trxB LENGTH 303 SQ:AASEQ MYDTIIIGAGPAGMTAALYAARSNLKVALIEGGLPGGQMNNTSDIENYPGYANISGPELAEKMFEPLENLGVEHIYGYVENVEDHGDFKKVMTDDQTYETRTVIVATGSKHRPLGVPGEEELNSRGVSYCAVCDGAFFRDQDLLVVGGGDSAVEEALFLTRFAKTVTIVHRRDQLRAQKVLQDRAFANEKISFIWDSVVREIKGENRVESVVFENVKTGQVTEQAFGGVFIYVGLDPLSDFVKELNIQDQAGWIVTDNHMKTAVDGIFAVGDVRLKDLRQVTTAVGDGAIAGQEAYKFITEHS GT:EXON 1|1-303:0| BL:SWS:NREP 1 BL:SWS:REP 1->299|TRXB_LISMO|3e-96|55.9|299/319| PROS 130->150|PS00573|PYRIDINE_REDOX_2|PDOC00496| BL:PDB:NREP 1 BL:PDB:REP 2->291|2q7vB|2e-64|43.1|290/309| RP:PDB:NREP 1 RP:PDB:REP 3->302|2a87B|1e-55|46.0|300/304| RP:PFM:NREP 1 RP:PFM:REP 3->273|PF07992|3e-24|35.0|266/275|Pyr_redox_2| HM:PFM:NREP 1 HM:PFM:REP 3->274|PF07992|6.7e-45|36.3|193/202|Pyr_redox_2| RP:SCP:NREP 2 RP:SCP:REP 2->113|2gqfA1|1e-10|23.2|112/253|c.3.1.8| RP:SCP:REP 84->293|1mo9A1|9e-26|12.0|209/261|c.3.1.5| HM:SCP:REP 1->301|1f8rA1|4.3e-58|30.6|291/371|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 2162 OP:NHOMOORG 1095 OP:PATTERN 11121125333454342122111125312442111111111111112111111111132312211111 2331311122131211112-12112211111122222453242231121121432122--3322233251112222222213213---222212221-1223233523221111111111111112224232233312223111224-121112211122211111312212122222122222322211134355555444554444444554445533343343333338723333333333333332243332222222222233222225324333333233233222222222222333333333333222222222312235333333343423333443233314124244232213313331321312433311111233532223423411111111111144334221132231112231212312111232232211111111111133212322222222222222222222222221323223332112211244342211112279222212336336423333343322432322321222111111111112132211113352354431111111121114113142212211111111111111121111112222223122222222222222222222221-2111111111122221212222222222-2232222222222222223222221122222112111222222122222221111111111111111-2111111111121141111111111-11114333423222233333232232222422211111111111112111112222233334332232222121133111111111111114----1-11111212221111111112211122212121 ----111----122313111121121111111111111111111111111111111111111211121-1221112212211111121-11131111111111221113---1-1--------1-----------2-------------------11-1----1---3--1----1351-111324323132111---3 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 303 STR:RPRED 100.0 SQ:SECSTR cEcEEEEccHHHHHHHHHHHHHTTcccEEEcccccccGGGccccccccTTcTTccHHHHHHHHHHHHHHTTcEEEcccEEEEEcccccEEEEETTccEEEcEEEEcccEEEcccccTHHHHTcTTTEEccHHHHGGGGTTcEEEEEcccHHHHHHHHHHTTTccEEEEEcccccccccTTHHHHHHHcTTEEEEccEEEEEEEccccccEEEEEEETTcccEEEccccEEEcccEEEccTTTTTTcccTTccccccTTccccccTTEEEcGGGTccccccHHHHHHHHHHHHHHHHHHHHHcc DISOP:02AL 302-304| PSIPRED cccEEEEcccHHHHHHHHHHHHccccEEEEEccccccEEEEEcccccccccccccHHHHHHHHHHHHHHcccEEEEEEEEEEEccccEEEEEEccEEEEEEEEEEEcccccccccccccHHcccccEEEEHHHcccHHcccEEEEEcccHHHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHHHcccEEEEccEEEEEEEcccEEEEEEEEcccccEEEEEccEEEEEEcEEcccHHHHHccccccccEEEEccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHccc //