[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : uvrB
DDBJ      :uvrB         excinuclease ABC, B subunit
Swiss-Prot:UVRB_STRP7   RecName: Full=UvrABC system protein B;         Short=Protein uvrB;AltName: Full=Excinuclease ABC subunit B;

Homologs  Archaea  27/68 : Bacteria  885/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
a.2.9b.7.1c.37.1
:662 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->655 2d7dA PDBj 0.0 71.2 %
:RPS:PDB   7->600 1d9zA PDBj e-160 73.7 %
:RPS:PDB   623->660 2d7dB PDBj 8e-08 50.0 %
:RPS:SCOP  6->62 2yrbA1  b.7.1.1 * 2e-13 7.0 %
:RPS:SCOP  54->390 2b2nA1  c.37.1.19 * 2e-74 23.0 %
:RPS:SCOP  420->593 1c4oA2  c.37.1.19 * 4e-24 62.6 %
:RPS:SCOP  621->661 1qojA  a.2.9.1 * 1e-07 29.3 %
:HMM:SCOP  7->419 1d9xA1 c.37.1.19 * 7e-140 45.9 %
:HMM:SCOP  418->603 2eyqA5 c.37.1.19 * 3.6e-38 31.1 %
:HMM:SCOP  611->664 1e52A_ a.2.9.1 * 1.8e-06 42.6 %
:RPS:PFM   22->144 PF04851 * ResIII 2e-30 52.0 %
:RPS:PFM   474->548 PF00271 * Helicase_C 6e-07 40.0 %
:RPS:PFM   556->599 PF12344 * UvrB 2e-12 72.7 %
:HMM:PFM   556->599 PF12344 * UvrB 5.7e-27 75.0 44/44  
:HMM:PFM   469->549 PF00271 * Helicase_C 2.4e-18 39.5 76/78  
:HMM:PFM   18->95 PF04851 * ResIII 1e-15 30.8 78/184  
:HMM:PFM   626->660 PF02151 * UVR 9e-13 45.7 35/36  
:HMM:PFM   251->283 PF01452 * Rota_NSP4 0.00073 36.4 33/174  
:BLT:SWISS 1->662 UVRB_STRP7 0.0 100.0 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54909.1 GT:GENE uvrB GT:PRODUCT excinuclease ABC, B subunit GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1104567..1106555) GB:FROM 1104567 GB:TO 1106555 GB:DIRECTION - GB:GENE uvrB GB:PRODUCT excinuclease ABC, B subunit GB:NOTE identified by match to protein family HMM PF00271; match to protein family HMM PF02151; match to protein family HMM PF04851; match to protein family HMM TIGR00631 GB:PROTEIN_ID ACF54909.1 GB:DB_XREF GI:194356461 GB:GENE:GENE uvrB LENGTH 662 SQ:AASEQ MINHITDNQFKLVSKYQPSGDQPQAIEQLVDNIEGGEKAQILMGATGTGKTYTMSQVISKVNKPTLVIAHNKTLAGQLYGEFKEFFPENAVEYFVSYYDYYQPEAYVPSSDTYIEKDSSVNDEIDKLRHSATSALLERNDVIVVASVSCIYGLGSPKEYADSVVSLRPGLEISRDKLLNDLVDIQFERNDIDFQRGRFRVRGDVVEIFPASRDEHAFRVEFFGDEIDRIREVEALTGQVLGEVDHLAIFPATHFVTNDDHMEVAVAKIQAELEEQLAVFEKEGKLLEAQRLKQRTEYDIEMLREMGYTNGVENYSRHMDGRSEGEPPYTLLDFFPDDFLIMIDESHMTMGQIKGMYNGDRSRKEMLVNYGFRLPSALDNRPLRREEFESHVHQIVYVSATPGDYENEQTETVIEQIIRPTGLLDPEVEVRPTMGQIDDLLGEINARVEKNERTFITTLTKKMAEDLTDYFKEMGIKVKYMHSDIKTLERTEIIRDLRLGVFDVLVGINLLREGIDVPEVSLVAILDADKEGFLRNERGLIQTIGRAARNSEGHVIMYADTVTQSMQRAIDETARRRKIQMAYNEEHGIVPQTIKKEIRDLIAVTKAVAKEEDKEVDINSLNKQERKELVKKLEKQMQEAVEVLDFELAAQIRDMMLEVKALD GT:EXON 1|1-662:0| SW:ID UVRB_STRP7 SW:DE RecName: Full=UvrABC system protein B; Short=Protein uvrB;AltName: Full=Excinuclease ABC subunit B; SW:GN Name=uvrB; OrderedLocusNames=SP70585_1301; SW:KW ATP-binding; Complete proteome; Cytoplasm; DNA damage; DNA excision;DNA repair; Excision nuclease; Helicase; Hydrolase;Nucleotide-binding; SOS response. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->662|UVRB_STRP7|0.0|100.0|662/662| GO:SWS:NREP 10 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006974|"GO:response to DNA damage stimulus"|DNA damage| GO:SWS GO:0006281|"GO:DNA repair"|DNA excision| GO:SWS GO:0006281|"GO:DNA repair"|DNA repair| GO:SWS GO:0004518|"GO:nuclease activity"|Excision nuclease| GO:SWS GO:0004386|"GO:helicase activity"|Helicase| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0009432|"GO:SOS response"|SOS response| COIL:NAA 13 COIL:NSEG 1 COIL:REGION 277->289| BL:PDB:NREP 1 BL:PDB:REP 8->655|2d7dA|0.0|71.2|621/621| RP:PDB:NREP 2 RP:PDB:REP 7->600|1d9zA|e-160|73.7|590/590| RP:PDB:REP 623->660|2d7dB|8e-08|50.0|38/38| RP:PFM:NREP 3 RP:PFM:REP 22->144|PF04851|2e-30|52.0|123/177|ResIII| RP:PFM:REP 474->548|PF00271|6e-07|40.0|70/76|Helicase_C| RP:PFM:REP 556->599|PF12344|2e-12|72.7|44/44|UvrB| HM:PFM:NREP 5 HM:PFM:REP 556->599|PF12344|5.7e-27|75.0|44/44|UvrB| HM:PFM:REP 469->549|PF00271|2.4e-18|39.5|76/78|Helicase_C| HM:PFM:REP 18->95|PF04851|1e-15|30.8|78/184|ResIII| HM:PFM:REP 626->660|PF02151|9e-13|45.7|35/36|UVR| HM:PFM:REP 251->283|PF01452|0.00073|36.4|33/174|Rota_NSP4| GO:PFM:NREP 6 GO:PFM GO:0003677|"GO:DNA binding"|PF04851|IPR006935| GO:PFM GO:0005524|"GO:ATP binding"|PF04851|IPR006935| GO:PFM GO:0016787|"GO:hydrolase activity"|PF04851|IPR006935| GO:PFM GO:0003676|"GO:nucleic acid binding"|PF00271|IPR001650| GO:PFM GO:0004386|"GO:helicase activity"|PF00271|IPR001650| GO:PFM GO:0005524|"GO:ATP binding"|PF00271|IPR001650| RP:SCP:NREP 4 RP:SCP:REP 6->62|2yrbA1|2e-13|7.0|57/142|b.7.1.1| RP:SCP:REP 54->390|2b2nA1|2e-74|23.0|296/308|c.37.1.19| RP:SCP:REP 420->593|1c4oA2|4e-24|62.6|174/174|c.37.1.19| RP:SCP:REP 621->661|1qojA|1e-07|29.3|41/46|a.2.9.1| HM:SCP:REP 7->419|1d9xA1|7e-140|45.9|412/413|c.37.1.19|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 418->603|2eyqA5|3.6e-38|31.1|177/0|c.37.1.19|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 611->664|1e52A_|1.8e-06|42.6|54/56|a.2.9.1|1/1|C-terminal UvrC-binding domain of UvrB| OP:NHOMO 1303 OP:NHOMOORG 927 OP:PATTERN ------------------------11111111111---1111111111-1111-------------11 1211211111111111111-11111111111112222122212111111111122212111121222111211111112111111111111212221--1122221111111111111111111111111121111111112211111121111111112222111211212121111111111111111122222222222222222222222222222222222222222222222222322222222222221322313232222222221212222222222222222222222222222222222222232222222212222222222222222222222222222222222222222322221111111111112111111111111111111111111111-1111111111111111111111111111111211111111111111111111111111---------11221121111111111112221111111111111111111211111-111111111111111111111111211111111112211211111112412111121111122222121211111121111111111111111111111111111111212111212211111322212222122--11111------21221212212222222-2222222222222222222111222222222222222222222222112222-222222222222--11111112222122212222222221212211111111111111111111111111111121111111112222-111121222111111111111111-1111222211111111111111-1-11111111111111111111111111211111 ----------------------------------------------------------------------------------------------1-------------2--------------------------------------------------1---1---------111--17111--1------1-----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 659 STR:RPRED 99.5 SQ:SECSTR ##EEETcccccccccccccTTHHHHHHHHHHHHHTTccEEEEEEcTTccHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHHHccccEEEEEccTTcccccccEETTTTEEccccccccTHHHHHHHHHHHHTTTcccEEEEEcGGGGccccccTTTccccEEEEccccccTTTHHHHTTTTTcccccccccccccccccTTccccEEccccTTcccccEEEccccEcEEEcccccccccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccTTcccccHHHHHHHHHHHHTccccccGGGGHHHHHTccTTcccccGGGccccccEEEETTHHHHHHHHHTHHHHHHHHHHHHHHTTcccGGGTTcccccHHHHHTTcccEEEEcccccHHHHTTcccEEEEcccTTcccccEEEEEccTTHHHHHHHHHHHHHTTTcEEEEEcccHHHHHHHHHHHHTTcccccccccccccHHHHHHHHHHTTTcccccEEcccccTTcccccEEEEEETTTTcccGGGcHHHHHHHHGGGcccTTcEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHTTcccccccccccccHHccccccTTGGGcccHHHHHHHHHHHTHHHHHHHHHHHHHTTcHHHHHHHHHHcGGGGGG# DISOP:02AL 1-7,601-626,661-663| PSIPRED cccccccccEEEEEccccccccHHHHHHHHHHHHcccccEEEccccccHHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHHHcccccEEEEcccccccccEEccccccccHHHHccccHHHHHHHHHHHHHHHccccEEEEccHHHHcccccHHHHHHcEEEEEEcccccHHHHHHHHHHcccEEccccccccEEEEEccEEEEEccccccccEEEEccccEEEEEEEEEcccccEEEEccEEEEEccccEEccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHccccccccccHHHHHHcccccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHcccccHHccccccccHHHHHHHHHHHEEEcccHHHHHHHHHcccHHHEEEccccccccEEEEEcccHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHcccccEEEEccHHHHccccccccEEEEEccccccccccHHHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccHHHHHHHHHHHHHHHHHHHccHHcccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcc //