[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : xseB
DDBJ      :xseB         exodeoxyribonuclease VII, small subunit
Swiss-Prot:EX7S_STRZT   RecName: Full=Exodeoxyribonuclease 7 small subunit;         EC=3.1.11.6;AltName: Full=Exodeoxyribonuclease VII small subunit;         Short=Exonuclease VII small subunit;

Homologs  Archaea  0/68 : Bacteria  107/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.7.13
:70 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  1->66 1vp7A  a.7.13.1 * 1e-09 30.3 %
:HMM:SCOP  3->70 1vp7B_ a.7.13.1 * 9.9e-14 36.8 %
:HMM:PFM   7->56 PF02609 * Exonuc_VII_S 1.2e-20 48.0 50/53  
:BLT:SWISS 1->70 EX7S_STRZT 2e-34 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55335.1 GT:GENE xseB GT:PRODUCT exodeoxyribonuclease VII, small subunit GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1076550..1076762) GB:FROM 1076550 GB:TO 1076762 GB:DIRECTION - GB:GENE xseB GB:PRODUCT exodeoxyribonuclease VII, small subunit GB:NOTE identified by match to protein family HMM PF02609; match to protein family HMM TIGR01280 GB:PROTEIN_ID ACF55335.1 GB:DB_XREF GI:194356887 GB:GENE:GENE xseB LENGTH 70 SQ:AASEQ MSKQKKFEENLAELETIVQSLENGEIALEDAITAFQKGMVLSKELQATLDKAEKTLVKVMQEDGTESDFE GT:EXON 1|1-70:0| SW:ID EX7S_STRZT SW:DE RecName: Full=Exodeoxyribonuclease 7 small subunit; EC=3.1.11.6;AltName: Full=Exodeoxyribonuclease VII small subunit; Short=Exonuclease VII small subunit; SW:GN Name=xseB; OrderedLocusNames=SPT_1020; SW:KW Complete proteome; Cytoplasm; Exonuclease; Hydrolase; Nuclease. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->70|EX7S_STRZT|2e-34|100.0|70/70| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0004527|"GO:exonuclease activity"|Exonuclease| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0004518|"GO:nuclease activity"|Nuclease| HM:PFM:NREP 1 HM:PFM:REP 7->56|PF02609|1.2e-20|48.0|50/53|Exonuc_VII_S| RP:SCP:NREP 1 RP:SCP:REP 1->66|1vp7A|1e-09|30.3|66/68|a.7.13.1| HM:SCP:REP 3->70|1vp7B_|9.9e-14|36.8|68/0|a.7.13.1|1/1|XseB-like| OP:NHOMO 107 OP:NHOMOORG 107 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1-11---111111-----------------111--11111111-1-11111111111-11111111111111111111111111111111111111111111111--------1111-1-1--------------------------------1-----------------------------------------------------------------------------11111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------1---------------------------------------------------------------------------------------------------------------------1--------------------------------111----1-111---------------------------------------1--------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,64-71| PSIPRED ccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc //