[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : yajC
DDBJ      :yajC         preprotein translocase, YajC subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  99/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:99 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   4->85 PF02699 * YajC 1e-07 40.0 %
:HMM:PFM   6->85 PF02699 * YajC 6.7e-24 35.9 78/83  
:BLT:SWISS 7->85 Y1229_BACHD 8e-09 37.2 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54887.1 GT:GENE yajC GT:PRODUCT preprotein translocase, YajC subunit GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1844559..1844858) GB:FROM 1844559 GB:TO 1844858 GB:DIRECTION - GB:GENE yajC GB:PRODUCT preprotein translocase, YajC subunit GB:NOTE identified by match to protein family HMM PF02699; match to protein family HMM TIGR00739 GB:PROTEIN_ID ACF54887.1 GB:DB_XREF GI:194356439 GB:GENE:GENE yajC LENGTH 99 SQ:AASEQ MNPNITFLIMLVGMMALMFFMQRSQKKQAQKRMESLNKLQKGYEVITIGGLYGTVDEVDTEKGTIVLDVDGVYLTFELAAIKTVLPLKETASLEGAIEK GT:EXON 1|1-99:0| BL:SWS:NREP 1 BL:SWS:REP 7->85|Y1229_BACHD|8e-09|37.2|78/88| TM:NTM 1 TM:REGION 2->23| RP:PFM:NREP 1 RP:PFM:REP 4->85|PF02699|1e-07|40.0|80/82|YajC| HM:PFM:NREP 1 HM:PFM:REP 6->85|PF02699|6.7e-24|35.9|78/83|YajC| OP:NHOMO 99 OP:NHOMOORG 99 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------1--1---11-----------------------------------------------------------111111111111111------111-------1--------111111111111111----1-1-11-1---11111111111111111111111111111111111111111111111111--111---1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,24-39,92-100| PSIPRED ccccEEHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccEEEEEccEEEEEEEEEccEEEEEEEcccEEEEEEEHHHHHHccccccccHHHcccc //