[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54062.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:74 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   32->59 PF02925 * gpD 0.0009 50.0 28/141  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54062.1 GT:GENE AAZ54062.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(28370..28594) GB:FROM 28370 GB:TO 28594 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ54062.1 GB:DB_XREF GI:71914160 LENGTH 74 SQ:AASEQ MSQTHDALSRDLAPVVTRLSAEFKDVHPESIVSRCVTAARNGAEDVVGYATPELVERIARQHLKVLALALAEQR GT:EXON 1|1-74:0| HM:PFM:NREP 1 HM:PFM:REP 32->59|PF02925|0.0009|50.0|28/141|gpD| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHccccHHHHHHHHHHHHHHHHHHHHHcc //