[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54075.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:122 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54075.1 GT:GENE AAZ54075.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(40654..41022) GB:FROM 40654 GB:TO 41022 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ54075.1 GB:DB_XREF GI:71914173 LENGTH 122 SQ:AASEQ MPTPCDIVSDSNREITLGAHLSIDGRLTANGHHLKGLSHMRQMTRLATVGAMSLALVGASASAALAGYHEFSSEETFTNIDQCVVVQQLEAGGLTLPDIIPPDLLGGSAYNCIGNEVVVVNE GT:EXON 1|1-122:0| SEG 50->67|gamslalvgasasaalag| SEG 96->107|lpdiippdllgg| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccccccccccccEEEEEEEEEEccEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEccccccEEEEEEEEEEEEEccccccccHHccHHHcccccccccccEEEEEEc //