[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54079.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:121 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   64->99 PF11555 * Inhibitor_Mig-6 0.00045 27.8 36/68  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54079.1 GT:GENE AAZ54079.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 42815..43180 GB:FROM 42815 GB:TO 43180 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ54079.1 GB:DB_XREF GI:71914177 LENGTH 121 SQ:AASEQ MLLGLALPTQDPELILWPLHPPRSRTRPSLAGPWRHASPQDAGQSGRYSSVRTTAPAAGSHTASIPPQRTMADDTSRRPSPQTLNSTKQTMPVLPVNRNLAPDILATVLLSLQFGSPRFMG GT:EXON 1|1-121:0| HM:PFM:NREP 1 HM:PFM:REP 64->99|PF11555|0.00045|27.8|36/68|Inhibitor_Mig-6| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 35-50, 68-86| PSIPRED cEEEcccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccc //