[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54083.1
DDBJ      :             Conserved hypothetical protein 103
Swiss-Prot:Y045_THEFY   RecName: Full=UPF0133 protein Tfu_0045;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.222.1
:116 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   51->94 1ybxB PDBj 1e-04 38.5 %
:RPS:SCOP  48->98 1j8bA  d.222.1.1 * 1e-08 34.8 %
:HMM:SCOP  13->113 1pugA_ d.222.1.1 * 3.3e-26 48.9 %
:RPS:PFM   48->99 PF02575 * DUF149 1e-04 45.8 %
:HMM:PFM   13->107 PF02575 * DUF149 6.4e-31 47.3 91/93  
:BLT:SWISS 1->99 Y045_THEFY 2e-28 100.0 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54083.1 GT:GENE AAZ54083.1 GT:PRODUCT Conserved hypothetical protein 103 GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(46682..47032) GB:FROM 46682 GB:TO 47032 GB:DIRECTION - GB:PRODUCT Conserved hypothetical protein 103 GB:PROTEIN_ID AAZ54083.1 GB:DB_XREF GI:71914181 InterPro:IPR004401 LENGTH 116 SQ:AASEQ MNPGGGLDMQAILQQAQQMQQQLMAAQQELDETKVTGSSGGGLVSVTMNGRGQVEDVSIDPKAVDPDDAAETAQTIADLVLAAIRDGERMVEEIQQQKMGPLAQGLGGGFPGLPGL GT:EXON 1|1-116:0| SW:ID Y045_THEFY SW:DE RecName: Full=UPF0133 protein Tfu_0045; SW:GN OrderedLocusNames=Tfu_0045; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->99|Y045_THEFY|2e-28|100.0|99/116| COIL:NAA 32 COIL:NSEG 1 COIL:REGION 6->37| SEG 9->28|mqailqqaqqmqqqlmaaqq| SEG 33->47|tkvtgssggglvsvt| SEG 100->115|gplaqglgggfpglpg| BL:PDB:NREP 1 BL:PDB:REP 51->94|1ybxB|1e-04|38.5|39/88| RP:PFM:NREP 1 RP:PFM:REP 48->99|PF02575|1e-04|45.8|48/93|DUF149| HM:PFM:NREP 1 HM:PFM:REP 13->107|PF02575|6.4e-31|47.3|91/93|DUF149| RP:SCP:NREP 1 RP:SCP:REP 48->98|1j8bA|1e-08|34.8|46/92|d.222.1.1| HM:SCP:REP 13->113|1pugA_|3.3e-26|48.9|94/94|d.222.1.1|1/1|YbaB-like| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 38 STR:RPRED 32.8 SQ:SECSTR ##################################################TccEEEEEEcGGGccTTcH#####HHHHHHHHHHHHHHHHHHH####################### DISOP:02AL 1-10, 14-23, 91-106| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEEcccEEEEEEEcccEEEEEEEcHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //