[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54088.1
DDBJ      :             conserved hypothetical protein with similarity to AbiLI: abortive phage resistance protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  52/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:451 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  2->63 1w1wA  c.37.1.12 * 7e-06 31.1 %
:RPS:SCOP  36->361 1f2t.1  c.37.1.12 * 6e-06 22.0 %
:HMM:SCOP  43->361 1ii8.1 c.37.1.12 * 7.6e-10 16.7 %
:RPS:PFM   388->440 PF07792 * DUF1630 4e-04 41.5 %
:HMM:PFM   35->66 PF02463 * SMC_N 1e-07 40.6 32/220  
:BLT:SWISS 40->73 P115_MYCPN 4e-04 47.1 %
:PROS 115->128|PS00213|LIPOCALIN

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54088.1 GT:GENE AAZ54088.1 GT:PRODUCT conserved hypothetical protein with similarity to AbiLI: abortive phage resistance protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(53663..55018) GB:FROM 53663 GB:TO 55018 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein with similarity to AbiLI: abortive phage resistance protein GB:PROTEIN_ID AAZ54088.1 GB:DB_XREF GI:71914186 InterPro:IPR002345 LENGTH 451 SQ:AASEQ MLLRFRVANHRSIREEQELSLVAVPKRGEAKPKAHEIPPTVHVAGIYGANASGKSNVLDALRWMSAAVKYSHIHWQPDAGVPRKPFRLDDTSHEEPSFYEIDFVFEGVRHSYGFEVTDREVVGEWLFVFPHGRPKRLFEREGPQDYKFGKSLKGELRRIEKLTRPNSLYLSCAASNNHPYLSSIHHWIGTHIRFATQNSFDEGVRFRFTQSLIEDPGSKGAEYVSRLVRVADLGITDIVLSKREIDGFEKEFISFIRERLPDIPEEEFRKRIEQRPLFIHDYSGKPRPLPIDEESDGTRSWFGLVGFVLRVLEEGDVFLVDEIDSSLHPVLSSTLIRMFKDPVINPKGAQMVFASHDTTLLGTMLENKLLERDEVWFTEKDAHGATSLYSLVEFHPRGDENPERGYLQGRYGAVPHVNFQEIRSLFAELHGAAGEPSASAETGPPPESQYA GT:EXON 1|1-451:0| BL:SWS:NREP 1 BL:SWS:REP 40->73|P115_MYCPN|4e-04|47.1|34/982| PROS 115->128|PS00213|LIPOCALIN|PDOC00187| RP:PFM:NREP 1 RP:PFM:REP 388->440|PF07792|4e-04|41.5|53/537|DUF1630| HM:PFM:NREP 1 HM:PFM:REP 35->66|PF02463|1e-07|40.6|32/220|SMC_N| RP:SCP:NREP 2 RP:SCP:REP 2->63|1w1wA|7e-06|31.1|45/274|c.37.1.12| RP:SCP:REP 36->361|1f2t.1|6e-06|22.0|246/288|c.37.1.12| HM:SCP:REP 43->361|1ii8.1|7.6e-10|16.7|192/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 57 OP:NHOMOORG 52 OP:PATTERN -------------------------------------------------------------------- -1---111----------------------------1-------------1-------------------1------1---1-------1-3--11---------1-----------------------1--11--------------11-11---------------11----------------------1----------------------------1-------------------------------1-------------------------1---1----------------------------------------1-----------------------1----2----1------------21----------------------------------------------------------1--------------------------------------------------------------------------------------1---------1---------------11-------------------1------------1----------1------------1--------1-------------------------------------------------------------1-1--------------------------------------1--------------------------------------------1-------------1-----------------------1--1------1----------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 432-451| PSIPRED ccEEEEEEEEEEEcccEEEEEEEcccccccccccccccccEEEEEEEccccccHHHHHHHHHHHHHHHcccccccccccccccccEEEcccccccccEEEEEEEEccEEEEEEEEEcccccEEEEEEEEEccccEEEEEccccEEEEcccHHHHHHHHHcccccccHHEEEHHHHccccHHHHHHHHHHccEEEEEccccccccccEEcHHHHcccccHHHHHHHHHHHHHcccHHHcEEEccccccHHHHHHHHHHHHcccHHHEEHHHHHccEEEEEEEEcccEEEEcHHHccHHHHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHccccccEEEEEEccHHHHHHccccccEEEEEEEEEEEccccccEEEEEccccccccccHHHHHHcccccccccccHHHHHHHHHHHcccccccccccccccccccccc //