[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54116.1
DDBJ      :             branched-chain amino acid ABC transporter permease protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  117/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:374 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   80->186 PF02653 * BPD_transp_2 2e-06 37.7 %
:HMM:PFM   70->327 PF02653 * BPD_transp_2 1.5e-29 27.8 241/267  
:BLT:SWISS 64->306 BRAE_PSEAE 1e-13 41.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54116.1 GT:GENE AAZ54116.1 GT:PRODUCT branched-chain amino acid ABC transporter permease protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 97989..99113 GB:FROM 97989 GB:TO 99113 GB:DIRECTION + GB:PRODUCT branched-chain amino acid ABC transporter permease protein GB:PROTEIN_ID AAZ54116.1 GB:DB_XREF GI:71914214 InterPro:IPR001851 LENGTH 374 SQ:AASEQ MNVDTDTKHTTEAPAAPAAPVAEAVRRPRRVPAWVAPAVVAVVLLSLPFSTLRIPGLFEGTLNSPSTLHVLATCLVLGGLATSYDLLYGRVGLLSFGHALYFAAGAYLAVLLMGILELPLLWSALIAVASGTLLALVLGAISLRVSGIALAMVTLAFAQAGSILVVRDPGRMTGGEEGLSLNPDLVPDAFIGVVNTVNLYWLAVGYVVVALGVVWWLSATPVGRVWQGIRANEQRVSVLGVNPYPYKLAAFTVAGALASLGGVVYLVVSGGVTPAITTAEFTLTLLVMVSLGGAGTRWGPLVGAVVYTYVDHRLLQLAASDVFDGLPAVVRAPLSQPLFILGTLFVLLVFFFPGGLAALPSRIHAALRRRAAAA GT:EXON 1|1-374:0| BL:SWS:NREP 1 BL:SWS:REP 64->306|BRAE_PSEAE|1e-13|41.5|241/417| TM:NTM 8 TM:REGION 31->53| TM:REGION 92->114| TM:REGION 119->141| TM:REGION 147->169| TM:REGION 192->214| TM:REGION 247->269| TM:REGION 284->306| TM:REGION 343->365| SEG 13->43|apaapaapvaeavrrprrvpawvapavvavv| SEG 199->217|lywlavgyvvvalgvvwwl| SEG 253->272|vagalaslggvvylvvsggv| SEG 337->359|plfilgtlfvllvfffpgglaal| SEG 365->373|aalrrraaa| RP:PFM:NREP 1 RP:PFM:REP 80->186|PF02653|2e-06|37.7|106/271|BPD_transp_2| HM:PFM:NREP 1 HM:PFM:REP 70->327|PF02653|1.5e-29|27.8|241/267|BPD_transp_2| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF02653|IPR001851| GO:PFM GO:0006810|"GO:transport"|PF02653|IPR001851| GO:PFM GO:0016020|"GO:membrane"|PF02653|IPR001851| OP:NHOMO 198 OP:NHOMOORG 121 OP:PATTERN -----------------------11---1------------------1-------------------- ----1---------------------------------------------------------1-1--1--1-----------1------------------------------------------------------1111---1---------------------------------------11-------------111-11-111------11--1-----------1---------------------------------------------------------------------------------------------1--11111-1-1-----------1--1---------1------------------------1623--163344--------------1--3-1----111----1----13---313----211--------1----4-1-----------------------------------155-3111111-----1121------1-2261211---3-2111343461------------------112-31----------11---1112-1--1----11----------------------------11----------------------------------------------------------------------------------------------------------------------------------------1-1-----------------------------------------2---------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 8-21, 366-367, 369-374| PSIPRED cccccccccccccccccccccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHEEEEccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccc //