[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54129.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:63 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   11->57 PF04149 * DUF397 2e-07 53.2 %
:HMM:PFM   10->61 PF04149 * DUF397 2.8e-21 44.2 52/56  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54129.1 GT:GENE AAZ54129.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 113470..113661 GB:FROM 113470 GB:TO 113661 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ54129.1 GB:DB_XREF GI:71914227 LENGTH 63 SQ:AASEQ MHTPDPAPLAFRKSSYSVTAQECVEVAVTSEFVAVRDSAHRELGYLTFPLAEWRAFLTELTDR GT:EXON 1|1-63:0| RP:PFM:NREP 1 RP:PFM:REP 11->57|PF04149|2e-07|53.2|47/55|DUF397| HM:PFM:NREP 1 HM:PFM:REP 10->61|PF04149|2.8e-21|44.2|52/56|DUF397| OP:NHOMO 3 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------3---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccccccccccEEEEEEccccccEEEEEEccccccccccccccccEEEEcHHHHHHHHHHHccc //