[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54133.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:169 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   85->142 PF11118 * DUF2627 0.00025 29.3 58/77  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54133.1 GT:GENE AAZ54133.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(116630..117139) GB:FROM 116630 GB:TO 117139 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ54133.1 GB:DB_XREF GI:71914231 LENGTH 169 SQ:AASEQ MELGPVVGHGGNENSRAVPSGTFTNGLGADMTLERGNAFTPVASATLIWPWRSSVVAGGVAGVLALLTSLNEGVLSALGSGIGSAAFFFALVGGAVGALGSKGDRRARRYAAQYPWRFAMVPALIGGAGAAVGTLLSSGLILGILGGAATAAVLWVILGIITMVAGNKK GT:EXON 1|1-169:0| TM:NTM 4 TM:REGION 54->76| TM:REGION 81->103| TM:REGION 116->138| TM:REGION 144->166| SEG 55->67|vvaggvagvlall| SEG 83->101|gsaafffalvggavgalgs| SEG 132->154|vgtllssglilgilggaataavl| HM:PFM:NREP 1 HM:PFM:REP 85->142|PF11118|0.00025|29.3|58/77|DUF2627| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 168-169| PSIPRED ccccccccccccccccccccccccccccccEEEccccccccccccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccc //