[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54134.1
DDBJ      :             Phenazine biosynthesis PhzC/PhzF protein
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  260/915 : Eukaryota  80/199 : Viruses  0/175   --->[See Alignment]
d.21.1
:267 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->263 1s7jA PDBj 8e-41 43.0 %
:RPS:PDB   3->266 3ednA PDBj 1e-39 20.2 %
:RPS:SCOP  4->265 1s7jA  d.21.1.2 * 5e-69 42.6 %
:HMM:SCOP  1->267 1s7jA_ d.21.1.2 * 4e-75 48.0 %
:RPS:PFM   7->262 PF02567 * PhzC-PhzF 1e-43 50.0 %
:HMM:PFM   7->263 PF02567 * PhzC-PhzF 3.8e-71 42.8 257/282  
:BLT:SWISS 7->265 Y2770_PSEAE 3e-57 52.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54134.1 GT:GENE AAZ54134.1 GT:PRODUCT Phenazine biosynthesis PhzC/PhzF protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 117311..118114 GB:FROM 117311 GB:TO 118114 GB:DIRECTION + GB:PRODUCT Phenazine biosynthesis PhzC/PhzF protein GB:PROTEIN_ID AAZ54134.1 GB:DB_XREF GI:71914232 InterPro:IPR003719 LENGTH 267 SQ:AASEQ MNRFHVVDAFTDQPFHGNPAAVLVLDSPYDDAWAQRVAAEFNLSETAFVRPLAGADADYELRWFTPTTEVDLCGHATLAAAHVLAAGGAEGPFRFASRSGVLTVTARDGLLWLDFPANPPYAKDVPDGLVAALGGEPVWAGFSDVNDYFVVYPDEATVRALAPDLAEVARCTVRGVTVTAPADPGQPYDFVSRLFAPAIGIPEDPVTGSAHTALGPYWAQRLGRTRLDAVQCSARGGRLVVELPADAPDRVLIGGTAVTVSEGTLRY GT:EXON 1|1-267:0| BL:SWS:NREP 1 BL:SWS:REP 7->265|Y2770_PSEAE|3e-57|52.4|248/259| SEG 74->91|ghatlaaahvlaaggaeg| BL:PDB:NREP 1 BL:PDB:REP 4->263|1s7jA|8e-41|43.0|249/260| RP:PDB:NREP 1 RP:PDB:REP 3->266|3ednA|1e-39|20.2|258/289| RP:PFM:NREP 1 RP:PFM:REP 7->262|PF02567|1e-43|50.0|256/274|PhzC-PhzF| HM:PFM:NREP 1 HM:PFM:REP 7->263|PF02567|3.8e-71|42.8|257/282|PhzC-PhzF| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF02567|IPR003719| GO:PFM GO:0009058|"GO:biosynthetic process"|PF02567|IPR003719| RP:SCP:NREP 1 RP:SCP:REP 4->265|1s7jA|5e-69|42.6|251/260|d.21.1.2| HM:SCP:REP 1->267|1s7jA_|4e-75|48.0|256/260|d.21.1.2|1/1|Diaminopimelate epimerase-like| OP:NHOMO 426 OP:NHOMOORG 350 OP:PATTERN -------------------------1111111-----------1------1---------1------- --1-1---111-------------------------1-11--1-------------1---11----11111----------1-------------------1--11111-------------------------1---------1----111-1111----11111-111-----------------------111111112-1-111--1--1-11--1-----1111--11--------------------1------------------------1-1-------------------------------------------12-1111-112----211------1-------11-----1----11--1--21111---------1----------------------1-----1-1-------------1-11211--------11111111-----111------------------------------1111-------11-1-1--------------21---11--111-----111-1---1----1--------------------------------------1111-------1-----------------------11-1112--1-131--1------------1-------------11---111111111111-1111111111111--1--212111--21-111111111111111--1---11-1--------------2-----3222-12-1---------------2222221111--2242121-111111-------------1---11--122111-111-11----------2----11------------------------------------11-11------11 ------1-11--111-----------------------------------------------------------------1---------------111-1------14242-1-411111-1121121462-22111-11111-1111-111-1112-11-1-21-----441---111-1-113211-32-112211 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 266 STR:RPRED 99.6 SQ:SECSTR cEEEEEEEEccccETTcEEEEEEcccTTccHHHHHHHHHHHccccEEEEEccccTcccccEEEEEccccEcccHHHHHHHHHHHHHTTccccEEEEETTEEEEEEEEEcTTccEEEEEccEccccHHHHHHHTTccGGGccTTcccEEEEEEcccHHHHHHcccGGGHHHHcTcEEEEEEcccccTTccEEcEEccTTccccEEcccHHHHHHHHHHTccccccEEEEEEEcGTccEEEEEEEEccTTcEEEEEEcEEEEEEEEEE# PSIPRED ccEEEEEEEEccccccccEEEEEEccccccHHHHHHHHHHHcccEEEEEEEccccccEEEEEEEcccccccccccHHHHHHHHHHHHcccccEEEEEEcEEEEEEEEccEEEEEccccccccccccHHHHHHHccccEEEEEcccccEEEEEccHHHHHHccccHHHHHcccccEEEEEEEcccccccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHcccEEEEEEEEEcccEEEEEEEcccccEEEEEEEEEEEEEEEEEc //