[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54135.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  45/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.113.1
:299 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   41->139 3hhjB PDBj 3e-04 26.5 %
:RPS:PDB   39->143 2b0vA PDBj 2e-13 19.2 %
:RPS:SCOP  39->157 2b0vA1  d.113.1.1 * 1e-14 17.8 %
:HMM:SCOP  25->154 2fmlA2 d.113.1.6 * 5.2e-24 33.1 %
:RPS:PFM   54->134 PF00293 * NUDIX 1e-09 43.2 %
:HMM:PFM   35->145 PF00293 * NUDIX 2.5e-17 32.1 109/135  
:BLT:SWISS 7->156 Y1276_BIFLO 9e-27 40.7 %
:PROS 61->82|PS00893|NUDIX_BOX
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54135.1 GT:GENE AAZ54135.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(118103..119002) GB:FROM 118103 GB:TO 119002 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ54135.1 GB:DB_XREF GI:71914233 InterPro:IPR000086 LENGTH 299 SQ:AASEQ MVTAGDGDGWVILADGSRRWGLYGASGLLLYSVDESGTGHVLLQHRAPWTHQGGTWGLPGGARNSGESSVSAAIREFVEEVDGDLGTLSLLGIHRQDHQVWVFDTVLASVPERRPFTPGNPESESIRWIPVPDVPSMPLLPAFGKVWPEVAAALSEQLLLIVDTTVVPQSITPGALCHRLTELAQVGVTDDMLPPDVPLTPLHRRFPSVLLLVDAHSRAALPAPVHGVDVVQVSDGSAAAIAQLVSERLPQTRIVVATDHPDTRAQAAALGVHTAPVSWAYELAQREESSPVERGSSVT GT:EXON 1|1-299:0| BL:SWS:NREP 1 BL:SWS:REP 7->156|Y1276_BIFLO|9e-27|40.7|150/482| PROS 61->82|PS00893|NUDIX_BOX|PDOC00695| SEG 21->32|glygasglllys| BL:PDB:NREP 1 BL:PDB:REP 41->139|3hhjB|3e-04|26.5|98/131| RP:PDB:NREP 1 RP:PDB:REP 39->143|2b0vA|2e-13|19.2|104/146| RP:PFM:NREP 1 RP:PFM:REP 54->134|PF00293|1e-09|43.2|81/132|NUDIX| HM:PFM:NREP 1 HM:PFM:REP 35->145|PF00293|2.5e-17|32.1|109/135|NUDIX| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00293|IPR000086| RP:SCP:NREP 1 RP:SCP:REP 39->157|2b0vA1|1e-14|17.8|118/146|d.113.1.1| HM:SCP:REP 25->154|2fmlA2|5.2e-24|33.1|127/0|d.113.1.6|1/1|Nudix| OP:NHOMO 45 OP:NHOMOORG 45 OP:PATTERN -------------------------------------------------------------------- -----1-11111-111111-11--1111111111111111-----1--1111-11----------1----11-11111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 126 STR:RPRED 42.1 SQ:SECSTR ################################EcTTccTEEEEEEEcccccTccEEEccEEEccTTccHHHHHHHHHHHHHcEEEEEEEEEEEETTTTEEEEEEEEEEEEEEEcTTccccTTEEEEEEEEHHHHHHTGGcccTHHHHHHHHcTTccHc############################################################################################################################################# DISOP:02AL 1-2, 285-299| PSIPRED cccccccccEEEcccccccccccccEEEEEEEEEcccccEEEEEEcccccccccEEEccccEEcccccHHHHHHHHHHHHHcccEEEEEEEEEEccccccEEEEEEEEEEEcccccccccccHHEEEEccHHHHccccccHHHHHHHHHHHHHcHHHHHHcccHHHccccccHHccccHHHHHccccccccccccccccHHHHcccccEEEEEcccccccccccccccEEEEEcccHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHccccccHHHHHHHHHHccccHHccccccc //