[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54136.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:203 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   62->123 PF01284 * MARVEL 2.7e-06 35.7 56/144  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54136.1 GT:GENE AAZ54136.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 119935..120546 GB:FROM 119935 GB:TO 120546 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ54136.1 GB:DB_XREF GI:71914234 LENGTH 203 SQ:AASEQ MTNGPFPSESPSPQPSDGQGSTSGNIPEPVTQLAAQRGFGALIDMRSDGTRAEKALGGCAIAVGSLLLMVLVAYLAPEDDPFSFSLLRSVLRFFALFFLFVAVWAAAAGLRGLIVAPRSHYLYEGGIIYAAGKRLQPAAWEEISHLTTIYGNRATGTKGKILGYKVWLGDTTSFDVPLILTDGRDSFMDRIIHEVRSRNRPIR GT:EXON 1|1-203:0| TM:NTM 2 TM:REGION 55->77| TM:REGION 83->105| SEG 4->24|gpfpsespspqpsdgqgstsg| SEG 82->113|fsfsllrsvlrffalfflfvavwaaaaglrgl| HM:PFM:NREP 1 HM:PFM:REP 62->123|PF01284|2.7e-06|35.7|56/144|MARVEL| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-27, 199-203| PSIPRED cccccccccccccccccccccccccccHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccccEEEEccEEEEcccccccHHHHHHHHHHHHHccccccccccEEEEEEEEcccccccEEEEEEcccHHHHHHHHHHHHHcccccc //