[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54137.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:118 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->43 PF05887 * Trypan_PARP 0.00042 28.9 38/143  
:HMM:PFM   58->114 PF05745 * CRPA 0.00066 26.9 52/150  
:BLT:SWISS 4->49 ZEP3_MOUSE 4e-04 39.1 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54137.1 GT:GENE AAZ54137.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 120568..120924 GB:FROM 120568 GB:TO 120924 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ54137.1 GB:DB_XREF GI:71914235 LENGTH 118 SQ:AASEQ MAEQHTPEPHSSNRPQPEPVPNAEHTDAALSPSAEPPPYVPRPEALRHDLKVRGERAVIFGALWLLAGVLITLITYVNALQSFSGGIYVVAWGPAVYGLYRIISGLIMIKKSRTQSVN GT:EXON 1|1-118:0| BL:SWS:NREP 1 BL:SWS:REP 4->49|ZEP3_MOUSE|4e-04|39.1|46/100| TM:NTM 2 TM:REGION 55->77| TM:REGION 87->109| HM:PFM:NREP 2 HM:PFM:REP 5->43|PF05887|0.00042|28.9|38/143|Trypan_PARP| HM:PFM:REP 58->114|PF05745|0.00066|26.9|52/150|CRPA| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-25, 114-118| PSIPRED cccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHHHHHHHHHcccccccc //