Thermobifida fusca YX (tfus0)
Gene : AAZ54141.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:87 amino acids
:HMM:PFM   30->64 PF05887 * Trypan_PARP 0.00071 28.6 35/143  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54141.1 GT:GENE AAZ54141.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 125036..125299 GB:FROM 125036 GB:TO 125299 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ54141.1 GB:DB_XREF GI:71914239 LENGTH 87 SQ:AASEQ MGRQCRLPRVFRHTWGSRGWDRSAESRKGTTVTTPEENRPKTRGTEQTLPEPDVQAPKLPQPRPTLGAELEDAMRRSGLSREDFGKE GT:EXON 1|1-87:0| HM:PFM:NREP 1 HM:PFM:REP 30->64|PF05887|0.00071|28.6|35/143|Trypan_PARP| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 24-52, 80-87| PSIPRED ccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccHHccccc //