[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54142.1
DDBJ      :             putative integral membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  79/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:147 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->91 PF07681 * DoxX 6.9e-20 37.0 81/85  
:HMM:PFM   56->135 PF04173 * DoxD 0.00035 23.1 78/167  
:BLT:SWISS 2->132 Y886_HAEIN 8e-16 38.4 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54142.1 GT:GENE AAZ54142.1 GT:PRODUCT putative integral membrane protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 126888..127331 GB:FROM 126888 GB:TO 127331 GB:DIRECTION + GB:PRODUCT putative integral membrane protein GB:PROTEIN_ID AAZ54142.1 GB:DB_XREF GI:71914240 InterPro:IPR011592 LENGTH 147 SQ:AASEQ MNLDRYHGPVLALFRIVVGLMFLCHGVASLFGVLGGNQGTGQAVEFASWPGWWAALIQLVCGALVLLGLFTRPSAALASGSMAYAYFVVHQPHALLPLNNGGELAAMYCWAFFLIAILGPGAWALDHFILRRSSGTQQRLTAGTSAG GT:EXON 1|1-147:0| BL:SWS:NREP 1 BL:SWS:REP 2->132|Y886_HAEIN|8e-16|38.4|125/134| TM:NTM 3 TM:REGION 11->33| TM:REGION 51->73| TM:REGION 107->129| HM:PFM:NREP 2 HM:PFM:REP 11->91|PF07681|6.9e-20|37.0|81/85|DoxX| HM:PFM:REP 56->135|PF04173|0.00035|23.1|78/167|DoxD| OP:NHOMO 89 OP:NHOMOORG 79 OP:PATTERN -------------------------------------------------------------------- ----3---------3--11-11---111111-1111--11------------------------1-11211-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------1-1111---------------1-1111111-11--111122-222---------1-------------------------------------------------------11----------------------------------------------1--------1---1111111----------------------1--1-1----1----------------------------------------1------------------------------------------------------------------------------1-------------------------------------------------------1---111-1111-------------1--11-1-------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 132-140, 142-147| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHccccc //