[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54146.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  124/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.182.1
:167 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->147 1ng6A PDBj 2e-10 29.4 %
:RPS:PDB   15->138 3bmaE PDBj 3e-04 10.9 %
:RPS:SCOP  21->167 1ng6A  a.182.1.1 * 3e-21 28.1 %
:HMM:SCOP  19->167 1ng6A_ a.182.1.1 * 2.1e-38 44.6 %
:RPS:PFM   24->147 PF09424 * YqeY 5e-12 43.4 %
:HMM:PFM   22->166 PF09424 * YqeY 8.9e-51 53.1 143/143  
:BLT:SWISS 21->147 YQEY_BACSU 6e-10 29.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54146.1 GT:GENE AAZ54146.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 131789..132292 GB:FROM 131789 GB:TO 132292 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ54146.1 GB:DB_XREF GI:71914244 LENGTH 167 SQ:AASEQ MGKIAWSSPEGASSIPGMSELKTRLQADLTAAMKARDAVRTRALRMLLTAISNEEVSGKSARELSDDEIIKVITKEVKKRREAAEAFEQGGRADRAADERAEGEVLSEYLPEQLSDEELADLVRAAIAEAGVSDVKGMGAVMKLLTPRVAGRAEGRRVADEVRRQLS GT:EXON 1|1-167:0| BL:SWS:NREP 1 BL:SWS:REP 21->147|YQEY_BACSU|6e-10|29.4|126/148| SEG 68->82|eiikvitkevkkrre| SEG 90->104|ggradraaderaege| SEG 148->159|rvagraegrrva| BL:PDB:NREP 1 BL:PDB:REP 21->147|1ng6A|2e-10|29.4|126/148| RP:PDB:NREP 1 RP:PDB:REP 15->138|3bmaE|3e-04|10.9|119/390| RP:PFM:NREP 1 RP:PFM:REP 24->147|PF09424|5e-12|43.4|122/143|YqeY| HM:PFM:NREP 1 HM:PFM:REP 22->166|PF09424|8.9e-51|53.1|143/143|YqeY| RP:SCP:NREP 1 RP:SCP:REP 21->167|1ng6A|3e-21|28.1|146/148|a.182.1.1| HM:SCP:REP 19->167|1ng6A_|2.1e-38|44.6|148/148|a.182.1.1|1/1|GatB/YqeY motif| OP:NHOMO 124 OP:NHOMOORG 124 OP:PATTERN -------------------------------------------------------------------- -1--1111111----1111-1---11111111-11111111-1-1--1--------------1-1-11111---------------11-----------------------------------------1-11------------1------------------------1--------------------11----------------1-11-----1----1-------1---------------------11-------------11--11-----------------------------------------------------1---------1----1111--1-------11-------1------------------------------------------------------------11-111-----------------------------------------------------------------1-1-------------------------------------------1--------11111-----------1---------1-------111-11---11111------------------------1-1-11-1--------1------------1------------1--------------------------------------------------------------------------------------------11-1-1--------1----------------------1-------------------------------111-1111111-11----------------1-------------------------------------------1-----1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 132 STR:RPRED 79.0 SQ:SECSTR ##############ccHHHHHHHHHHccccHHHHHHHHHHHHHcTTcTTHHHHHHHHTTcc#ccHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHTHHHHHHHHTTccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHH#################### DISOP:02AL 1-4, 6-18| PSIPRED ccccccccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHc //