[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54151.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  55/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:57 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->56 PF08756 * YfkB 0.00039 27.5 51/153  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54151.1 GT:GENE AAZ54151.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 138090..138263 GB:FROM 138090 GB:TO 138263 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ54151.1 GB:DB_XREF GI:71914249 LENGTH 57 SQ:AASEQ MTKWEYATVPLLSHATKQILDNWGEDGWELVTVIPGPTIGDDPRNQQLVAYLKREKK GT:EXON 1|1-57:0| HM:PFM:NREP 1 HM:PFM:REP 6->56|PF08756|0.00039|27.5|51/153|YfkB| OP:NHOMO 55 OP:NHOMOORG 55 OP:PATTERN -------------------------------------------------------------------- ----1-1111111111-11-1---1111--11111111-1111111111111111111-11-1-1111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 55-57| PSIPRED ccccccccccHHHHHHHHHHHHcccccEEEEEEEEcccccccccccEEEEEEEcccc //