[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54155.1
DDBJ      :             Cyclic nucleotide-binding:Bacterial regulatory protein, Crp
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  576/915 : Eukaryota  36/199 : Viruses  0/175   --->[See Alignment]
a.4.5b.82.3
:228 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->214 3i54D PDBj 1e-60 57.4 %
:RPS:PDB   7->213 3e5uC PDBj 2e-34 17.2 %
:RPS:SCOP  2->126 1cx4A1  b.82.3.2 * 5e-23 24.2 %
:RPS:SCOP  149->211 2h6bA1  a.4.5.4 * 4e-08 20.6 %
:HMM:SCOP  7->148 2gauA2 b.82.3.2 * 1.3e-36 40.8 %
:HMM:SCOP  149->227 1omiA2 a.4.5.4 * 1.1e-19 40.5 %
:RPS:PFM   37->112 PF00027 * cNMP_binding 3e-18 47.4 %
:HMM:PFM   33->122 PF00027 * cNMP_binding 1.1e-28 43.3 90/91  
:HMM:PFM   178->197 PF00325 * Crp 3.2e-07 35.0 20/32  
:BLT:SWISS 19->63 S9A10_MOUSE 4e-04 37.8 %
:BLT:SWISS 40->199 CRP_SHIFL 5e-20 32.9 %
:PROS 82->99|PS00889|CNMP_BINDING_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54155.1 GT:GENE AAZ54155.1 GT:PRODUCT Cyclic nucleotide-binding:Bacterial regulatory protein, Crp GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(140729..141415) GB:FROM 140729 GB:TO 141415 GB:DIRECTION - GB:PRODUCT Cyclic nucleotide-binding:Bacterial regulatory protein, Crp GB:PROTEIN_ID AAZ54155.1 GB:DB_XREF GI:71914253 InterPro:IPR000595 InterPro:IPR001808 InterPro:IPR002373 LENGTH 228 SQ:AASEQ MVDETNEVLSKAPLFEALDEEGAAALRSSITEVRLGRGQTLFSEGDEGDRLYVMLSGKVKLTRKSADGRENLLAVLGPGEMLGELSLFDPGPRTASAVAVTDAVLAGLGHDDLRPFIMRQPEVAVHLLKALATRLRRTNDVVADLVFTDVPGRVAKALLDLAERFGKQSEDGLHVHHDLTQEELAQFVGASRETVNKALAEFALRGWLRIEAKAVVLLDVERLRRRAR GT:EXON 1|1-228:0| BL:SWS:NREP 2 BL:SWS:REP 19->63|S9A10_MOUSE|4e-04|37.8|45/1175| BL:SWS:REP 40->199|CRP_SHIFL|5e-20|32.9|158/210| PROS 82->99|PS00889|CNMP_BINDING_2|PDOC00691| SEG 127->138|llkalatrlrrt| SEG 215->227|vvlldverlrrra| BL:PDB:NREP 1 BL:PDB:REP 6->214|3i54D|1e-60|57.4|209/228| RP:PDB:NREP 1 RP:PDB:REP 7->213|3e5uC|2e-34|17.2|204/219| RP:PFM:NREP 1 RP:PFM:REP 37->112|PF00027|3e-18|47.4|76/90|cNMP_binding| HM:PFM:NREP 2 HM:PFM:REP 33->122|PF00027|1.1e-28|43.3|90/91|cNMP_binding| HM:PFM:REP 178->197|PF00325|3.2e-07|35.0|20/32|Crp| RP:SCP:NREP 2 RP:SCP:REP 2->126|1cx4A1|5e-23|24.2|124/136|b.82.3.2| RP:SCP:REP 149->211|2h6bA1|4e-08|20.6|63/82|a.4.5.4| HM:SCP:REP 7->148|2gauA2|1.3e-36|40.8|142/0|b.82.3.2|1/1|cAMP-binding domain-like| HM:SCP:REP 149->227|1omiA2|1.1e-19|40.5|79/0|a.4.5.4|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 1023 OP:NHOMOORG 612 OP:PATTERN -------------------------------------------------------------------- 147-311222211123211-12111211111111111111132411223---111121--534152131111111111----6-121211-1-111-----12-1213-1----------------1-------1-644331-13-53252213322111111333343441211111211-12211211--21111111-11111111-122-1111-331-13------411---------------------111112---11--11111121-11-------------------------------------------1-231233323332311----333-11-11--236643--3111112----12-1114------244534-4345422212222223-23111413313--2221-211-22111-2--22222213--------1----621------------------------------1131-1----2112122323211333333231232152--33213-11213221--311-131-------1--23337211211-34112-32332221222-27834-111----------------11---111111111-1-111111111111111111111--2212------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--11----1----123--11111111111111122122-1---2211-11324211123222----------111111111111111111111111------2-334444--------312-------------------------------------- --11----------------111111211-------1112111111-------------1--1--1--1-----------------------------------------------1---------------------------------------------11-1-------------1--1-1------1-1---11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 214 STR:RPRED 93.9 SQ:SECSTR HHHHHHccccccccccccccGGGGGGGGGcEEEEEcTTcEEEcTTcccccEEEEEEccEEEEEEcTTccEEEEEEEcTTcEEcccccccccccEEEEEEcccEEEEEEcHHHHHHHHHHcTHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHcEEETTEEEEcccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEcccE############## DISOP:02AL 228-229| PSIPRED ccHHHHHHHHHcHHHccccHHHHHHHHHHcEEEEEccccEEEcccccccEEEEEEEEEEEEEEEcccccEEEEEEEccccEEEEHHHHccccEEEEEEEEccEEEEEEEHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccEEEEEEccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEccEEEEEcHHHHHHHcc //