[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54164.1
DDBJ      :             putative integral membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:246 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   130->195 3c1qB PDBj 3e-04 17.5 %
:HMM:PFM   110->230 PF00482 * GSPII_F 1.6e-14 23.9 117/124  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54164.1 GT:GENE AAZ54164.1 GT:PRODUCT putative integral membrane protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(148982..149722) GB:FROM 148982 GB:TO 149722 GB:DIRECTION - GB:PRODUCT putative integral membrane protein GB:PROTEIN_ID AAZ54164.1 GB:DB_XREF GI:71914262 LENGTH 246 SQ:AASEQ MTGLDVAVIALAAGTGALAVGDGRSPAERRLAALSAPALRRPPRLLPRLPRMLAAAAVLAACWALGGAGLGLFGSALLAGFVVWRRKRAAASPPSAGRDTEITAVLPLALDLLAAGLRAGAHPTDMVAAVAQALGGPLGTALDGVARQLRLGADPARAWQSLHAPAELAAVGRALARASHTGAPLADVVESHAADCRRTARATALELAHRTGVAVVIPLGVCFLPAFVLLGVVPLAAGLVSGLVLP GT:EXON 1|1-246:0| TM:NTM 3 TM:REGION 4->22| TM:REGION 55->77| TM:REGION 217->239| SEG 6->21|vavialaagtgalavg| SEG 24->80|rspaerrlaalsapalrrpprllprlprmlaaaavlaacwalggaglglfgsallag| SEG 89->96|aaasppsa| SEG 104->121|avlplaldllaaglraga| SEG 197->211|rrtaratalelahrt| SEG 224->245|lpafvllgvvplaaglvsglvl| RP:PDB:NREP 1 RP:PDB:REP 130->195|3c1qB|3e-04|17.5|63/112| HM:PFM:NREP 1 HM:PFM:REP 110->230|PF00482|1.6e-14|23.9|117/124|GSPII_F| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 66 STR:RPRED 26.8 SQ:SECSTR ##############################################################################################################################HHHHHHTcccHHHHHHHHHHHHHHTTccHHHHHTTc###TTTccHHHHHHHHHHHHTcHHHHHHHHHHH################################################### DISOP:02AL 1-2| PSIPRED cccHHHHHHHHHHccccEEEcccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //