[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54168.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  40/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.265.1
:270 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   141->249 3dd9D PDBj 2e-14 12.0 %
:HMM:SCOP  75->271 2g03A1 a.265.1.1 * 4.5e-07 22.7 %
:HMM:PFM   130->196 PF02661 * Fic 1.4e-05 26.6 64/96  
:BLT:SWISS 2->89 ISPH_DESVM 4e-04 37.5 %
:BLT:SWISS 77->150 ARFL_ORYSJ 3e-04 33.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54168.1 GT:GENE AAZ54168.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(153502..154314) GB:FROM 153502 GB:TO 154314 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ54168.1 GB:DB_XREF GI:71914266 LENGTH 270 SQ:AASEQ MNAVPTDPLMRIAEIPEVARAVDETRSLVDMLIGQRVLRRRGSDVSMEAALRGARASAVLEGADVSLEQVRFGESDDPRVRGSVRVSGELGLLVETWSKAPRQVLARLHVLAASDVVAPEALGRPRRDGDDVTDPLELGSPPPASEVIARLEALTSLLTARTEAPAVVVGAIVHGELLALRPFGWGDGIVARAAERLTLMARGLDPNSLVPTQLGHEQRREHYAAALRGYMTGTPEGVAGWVVHCAQAVMEGARDSLATCEAIRRATTRR GT:EXON 1|1-270:0| BL:SWS:NREP 2 BL:SWS:REP 2->89|ISPH_DESVM|4e-04|37.5|88/281| BL:SWS:REP 77->150|ARFL_ORYSJ|3e-04|33.8|68/818| RP:PDB:NREP 1 RP:PDB:REP 141->249|3dd9D|2e-14|12.0|100/119| HM:PFM:NREP 1 HM:PFM:REP 130->196|PF02661|1.4e-05|26.6|64/96|Fic| HM:SCP:REP 75->271|2g03A1|4.5e-07|22.7|176/0|a.265.1.1|1/1|Fic-like| OP:NHOMO 40 OP:NHOMOORG 40 OP:PATTERN -------------------------------------------------------------------- ----1------1-111111-11111-11111111111111-111---1------------11--1111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 245 STR:RPRED 90.7 SQ:SECSTR ####################HHHHHHHHHHHTccHHHHHH###HHHHHHHHHHHHHHHHTTTccccHHHHHcccHHHHHHHHHHHHHHHHHHHHcTTccccHHHHHHHHHHHccccc#cccccccccccccEEccTcEEccccHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHTTccccHHHHHHHHHHHHHHHHTTccccccGGGHHHHTHHHHHHHHHHHTcccccHHHHHHHHHHHccccHHHHHHHHHHHTTccTcccc# DISOP:02AL 1-2, 267-270| PSIPRED ccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccccccccccEEccccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //