[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54169.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:153 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   31->142 PF07332 * DUF1469 1e-08 36.7 %
:HMM:PFM   30->147 PF07332 * DUF1469 1.1e-29 36.4 118/121  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54169.1 GT:GENE AAZ54169.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 154466..154927 GB:FROM 154466 GB:TO 154927 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ54169.1 GB:DB_XREF GI:71914267 LENGTH 153 SQ:AASEQ MCPMEGAAAVSKTNTGGRKPVDVDAPRRSLGELTSEVTGHLSHLVSLQLELARTELAADVRRVVQGTALVITAALVAHLILILASMTIAFALIAFGLPGWLAFLIVTLVYTLVAVILGIVGVRSYKKIRGMPRSKETFDKTKAVLRREHTAQQ GT:EXON 1|1-153:0| TM:NTM 2 TM:REGION 65->87| TM:REGION 101->123| SEG 67->84|talvitaalvahlilila| RP:PFM:NREP 1 RP:PFM:REP 31->142|PF07332|1e-08|36.7|109/119|DUF1469| HM:PFM:NREP 1 HM:PFM:REP 30->147|PF07332|1.1e-29|36.4|118/121|DUF1469| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------1-1---1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-20, 149-153| PSIPRED ccccccHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccc //