[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54173.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  183/915 : Eukaryota  10/199 : Viruses  0/175   --->[See Alignment]
c.60.1
:157 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->146 2rflF PDBj 6e-09 39.5 %
:RPS:PDB   2->140 2a6pA PDBj 4e-16 24.5 %
:RPS:SCOP  2->77 1ebbA  c.60.1.1 * 8e-14 27.0 %
:HMM:SCOP  1->143 1e58A_ c.60.1.1 * 8.7e-28 31.5 %
:RPS:PFM   5->74 PF00300 * PGAM 2e-11 45.7 %
:HMM:PFM   4->74 PF00300 * PGAM 2.8e-20 36.6 71/158  
:BLT:SWISS 8->153 Y1276_MYCTU 2e-16 37.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54173.1 GT:GENE AAZ54173.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 159489..159962 GB:FROM 159489 GB:TO 159962 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ54173.1 GB:DB_XREF GI:71914271 LENGTH 157 SQ:AASEQ MSRRLVVLRHAQAEHSASLADVDRPLTQEGRQQARMVGERLAREGLLPDHVLCSTARRTRQTWDLVAEQLPCEPEVDFDAELYTADVDTALQLVSYVDPQVRTLLVVGHNPTMAQLAAAFDSESGYLSFPPASVAVVDLDVDWLYIAPGTGRLRLVM GT:EXON 1|1-157:0| BL:SWS:NREP 1 BL:SWS:REP 8->153|Y1276_MYCTU|2e-16|37.3|142/158| BL:PDB:NREP 1 BL:PDB:REP 4->146|2rflF|6e-09|39.5|129/143| RP:PDB:NREP 1 RP:PDB:REP 2->140|2a6pA|4e-16|24.5|139/193| RP:PFM:NREP 1 RP:PFM:REP 5->74|PF00300|2e-11|45.7|70/158|PGAM| HM:PFM:NREP 1 HM:PFM:REP 4->74|PF00300|2.8e-20|36.6|71/158|PGAM| RP:SCP:NREP 1 RP:SCP:REP 2->77|1ebbA|8e-14|27.0|74/202|c.60.1.1| HM:SCP:REP 1->143|1e58A_|8.7e-28|31.5|143/247|c.60.1.1|1/1|Phosphoglycerate mutase-like| OP:NHOMO 205 OP:NHOMOORG 193 OP:PATTERN -------------------------------------------------------------------- ----1--1111----1111-11111111111111111111-111-11-1---111-11--1111--121111111111---------------------------111-1---------------111-11--121-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111------11111111111111111111-111-11111111121-11112121112211-1--1111111-111111111-1111-1--------------------------------111--------------------------------1-------------------1-----------------------1--------------1-2----------211111111---------------2------1----------------------------------------------------------------------------------------------------------------------------1---------1-1---------------------------1---------------------------1--------------11111111111111--1-11----------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-3---1111-1-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 157 STR:RPRED 100.0 SQ:SECSTR EcccEEEEEccccTTGGGcccccccccHHHHHHHHHHHHHHHTTcccccEEEEcccHHHHHHHHHTTccccEEcGGTccHHHHccTTHHHHHHHHHHHTTTccEEEEEcHHHHHHHHHHHGGGGGGccccTTEEEEEEEEEEEETTEEEEEEEEEEE DISOP:02AL 157-158| PSIPRED cccEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHccccccEEEccccccccHHHHHHHHHHccccccEEEEEEcccHHHHHHHHHHcccccccccccEEEEEEEcccHHHHHccccEEEEEc //