[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54195.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:160 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   25->85 PF00720 * SSI 3.1e-05 39.0 59/95  
:HMM:PFM   4->33 PF05745 * CRPA 0.00046 33.3 30/150  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54195.1 GT:GENE AAZ54195.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 181600..182082 GB:FROM 181600 GB:TO 182082 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ54195.1 GB:DB_XREF GI:71914293 LENGTH 160 SQ:AASEQ MMALLRSRRVQVGLAVAGILALLTTTAVTLLYRPWTSDTAPVVPAAAPPLEVLGAAPDGISYTDLGQQCTPQECYRPVGVTAEGLDAEEAIETIYTHLSDQGWERLLPEGETDPDEVPYSQSALSNGTVLVQGSLEPYVEGTTAGLLLAHRVPPPPSPQR GT:EXON 1|1-160:0| SEG 10->31|vqvglavagilalltttavtll| SEG 40->57|apvvpaaapplevlgaap| HM:PFM:NREP 2 HM:PFM:REP 25->85|PF00720|3.1e-05|39.0|59/95|SSI| HM:PFM:REP 4->33|PF05745|0.00046|33.3|30/150|CRPA| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 152-160| PSIPRED cccHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHcccccccccccccccccHHHHccccccccccccHHHHHHHHHHHHccccHHHHccccccccccccccHHHccccEEEEEccccccccccHHHEEEEEcccccccccc //