[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54199.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:76 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   28->72 PF03899 * ATP_synt_I 0.00011 26.7 45/100  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54199.1 GT:GENE AAZ54199.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 186124..186354 GB:FROM 186124 GB:TO 186354 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ54199.1 GB:DB_XREF GI:71914297 LENGTH 76 SQ:AASEQ MRRGSLKGPLGSHDRPASALTFRLVLAVFGAVVLLVGAVLAAVWADSVPLAVVLGAGFLAACLNVYWVSRRRRYER GT:EXON 1|1-76:0| TM:NTM 2 TM:REGION 20->42| TM:REGION 48->69| SEG 24->43|lvlavfgavvllvgavlaav| SEG 50->63|lavvlgagflaacl| HM:PFM:NREP 1 HM:PFM:REP 28->72|PF03899|0.00011|26.7|45/100|ATP_synt_I| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-13, 74-76| PSIPRED cccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccc //