[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54205.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  66/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:262 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   34->252 PF08889 * WbqC 6e-55 45.1 %
:HMM:PFM   34->253 PF08889 * WbqC 2e-77 47.7 216/219  
:BLT:SWISS 29->259 Y1507_MYCTU 4e-26 30.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54205.1 GT:GENE AAZ54205.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 193241..194029 GB:FROM 193241 GB:TO 194029 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ54205.1 GB:DB_XREF GI:71914303 LENGTH 262 SQ:AASEQ MRTAGGGISYPQPGTTALDRLREGELTVRVAMHQPHYLPWLGLLDKIDRCDLFVVLDHVQFERKGWQHRNYVASKNGPVLLTVPVVQRSRDERIMDKSVNNSSPWWEKHSRTLAQHCYRKAPFWDEFGAEITAIYERRWEQLVDLSLATTEFVLNAFGITTPMVRSSELGEFTVQKSELLAQISAKVGATTMLSGDGARAYLDKDVFDRYGIAVEWQNFQHPEYPQHNRKGQEFLPRMAAIDLLLNVGPEGMDLVRQARIAD GT:EXON 1|1-262:0| BL:SWS:NREP 1 BL:SWS:REP 29->259|Y1507_MYCTU|4e-26|30.4|227/100| RP:PFM:NREP 1 RP:PFM:REP 34->252|PF08889|6e-55|45.1|215/219|WbqC| HM:PFM:NREP 1 HM:PFM:REP 34->253|PF08889|2e-77|47.7|216/219|WbqC| OP:NHOMO 68 OP:NHOMOORG 67 OP:PATTERN -----------------------------------------------1-------------------- ------------------------1-11111---------------------------------------1---------1--------------------11--1-11-----------------------1------------------------------------1----1------------------1-------------1---------1------1------1----------------------------------------------------------------------------------------------------1-------------------------1------------------11-----------------------------------------1------1-1-1--------------1-----------------1-------------------------------------1--111--1---------------1-----1--11---1------------------------1-1-1-----1----1111--1------------1--------------------------------------1-------1--1----1---1--------------1---------------------------------------11----------------------------------------------------------1-------------------------------1-------11-----------------------------------------------11------------------------------------------1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED ccccccccccccccccHHHHHccccEEEEEEEEccccccHHHHHHHHHHccEEEEEEccEEEEcccEEEEEEEcccccEEEEEEEEccccccccEEEEEccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccEEEEEccccccccHHHHHHHHHHHHcccccccccccHHHccHHHHHHcccEEcccccccccccccccccccccccHHHHHHHHHccHHHHHHHHHHHccc //